Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yafW-ykfI/CbtA-CbeA |
Location | 3981918..3982597 | Replicon | chromosome |
Accession | NZ_CP099291 | ||
Organism | Citrobacter freundii strain RHB03-E1-C03 |
Toxin (Protein)
Gene name | ykfI | Uniprot ID | A0A1B7JLK7 |
Locus tag | NFJ31_RS19350 | Protein ID | WP_003031349.1 |
Coordinates | 3982256..3982597 (+) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | yafW | Uniprot ID | A0A1B7JLJ2 |
Locus tag | NFJ31_RS19345 | Protein ID | WP_003031347.1 |
Coordinates | 3981918..3982235 (+) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFJ31_RS19320 (3978011) | 3978011..3980008 | - | 1998 | WP_016245729.1 | choline BCCT transporter BetT | - |
NFJ31_RS19325 (3980556) | 3980556..3980703 | + | 148 | Protein_3789 | hypothetical protein | - |
NFJ31_RS19330 (3980717) | 3980717..3981178 | + | 462 | WP_003031344.1 | antirestriction protein | - |
NFJ31_RS19335 (3981194) | 3981194..3981670 | + | 477 | WP_003031345.1 | RadC family protein | - |
NFJ31_RS19340 (3981679) | 3981679..3981900 | + | 222 | WP_003031346.1 | DUF987 domain-containing protein | - |
NFJ31_RS19345 (3981918) | 3981918..3982235 | + | 318 | WP_003031347.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
NFJ31_RS19350 (3982256) | 3982256..3982597 | + | 342 | WP_003031349.1 | type IV toxin-antitoxin system toxin YkfI | Toxin |
NFJ31_RS19360 (3983227) | 3983227..3983535 | - | 309 | WP_230132591.1 | isoprenylcysteine carboxylmethyltransferase family protein | - |
NFJ31_RS19365 (3983883) | 3983883..3985331 | - | 1449 | WP_044702495.1 | EAL domain-containing protein | - |
NFJ31_RS19370 (3985673) | 3985673..3986146 | - | 474 | WP_044702484.1 | hypothetical protein | - |
NFJ31_RS19375 (3986121) | 3986121..3986852 | - | 732 | WP_044702485.1 | winged helix-turn-helix domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 3967545..3994493 | 26948 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12921.01 Da Isoelectric Point: 9.6543
>T248311 WP_003031349.1 NZ_CP099291:3982256-3982597 [Citrobacter freundii]
MKTLPATTQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAVDILRARQATGLLRQSRNNVVR
MKTLPATTQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAVDILRARQATGLLRQSRNNVVR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1B7JLK7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1B7JLJ2 |