Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
Location | 4677980..4678683 | Replicon | chromosome |
Accession | NZ_CP099260 | ||
Organism | Klebsiella aerogenes strain RHB08-SO-C04 |
Toxin (Protein)
Gene name | ypjF | Uniprot ID | - |
Locus tag | NFJ54_RS22865 | Protein ID | WP_279281273.1 |
Coordinates | 4677980..4678321 (-) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | - |
Locus tag | NFJ54_RS22870 | Protein ID | WP_050131139.1 |
Coordinates | 4678342..4678683 (-) | Length | 114 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFJ54_RS22835 (NFJ54_22805) | 4673338..4673664 | + | 327 | WP_213315606.1 | hypothetical protein | - |
NFJ54_RS22840 (NFJ54_22810) | 4673702..4674337 | - | 636 | WP_086630702.1 | HNH endonuclease | - |
NFJ54_RS22845 (NFJ54_22815) | 4674517..4675386 | + | 870 | WP_086630701.1 | HNH endonuclease | - |
NFJ54_RS22850 (NFJ54_22820) | 4675422..4675763 | - | 342 | WP_116289501.1 | hypothetical protein | - |
NFJ54_RS22855 (NFJ54_22825) | 4675760..4676077 | - | 318 | WP_226938505.1 | type IV secretion protein Rhs | - |
NFJ54_RS22860 (NFJ54_22830) | 4676709..4677716 | - | 1008 | WP_196010439.1 | restriction endonuclease | - |
NFJ54_RS22865 (NFJ54_22835) | 4677980..4678321 | - | 342 | WP_279281273.1 | TA system toxin CbtA family protein | Toxin |
NFJ54_RS22870 (NFJ54_22840) | 4678342..4678683 | - | 342 | WP_050131139.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
NFJ54_RS22875 (NFJ54_22845) | 4678694..4679236 | - | 543 | WP_017880113.1 | DNA repair protein RadC | - |
NFJ54_RS22880 (NFJ54_22850) | 4679249..4679689 | - | 441 | WP_196010437.1 | antirestriction protein | - |
NFJ54_RS22885 (NFJ54_22855) | 4679720..4680541 | - | 822 | WP_196010436.1 | DUF932 domain-containing protein | - |
NFJ54_RS22890 (NFJ54_22860) | 4680662..4681135 | - | 474 | WP_196010435.1 | hypothetical protein | - |
NFJ54_RS22895 (NFJ54_22865) | 4681206..4681658 | - | 453 | WP_196010434.1 | hypothetical protein | - |
NFJ54_RS22900 (NFJ54_22870) | 4681694..4682410 | - | 717 | WP_057775073.1 | WYL domain-containing protein | - |
NFJ54_RS22905 (NFJ54_22875) | 4682654..4683529 | - | 876 | WP_196010433.1 | GTPase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4671839..4693561 | 21722 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12855.77 Da Isoelectric Point: 8.4941
>T248299 WP_279281273.1 NZ_CP099260:c4678321-4677980 [Klebsiella aerogenes]
MKTLPATNPQAATLYLSPVAVWQMLLARLLEQHYGLTLNDTPFSDETVIQEHIDAGISLADAVNFLVEKYGLARIDFRRF
DWQEQSPYLRAVDILRARQATGLLKRNRISAAR
MKTLPATNPQAATLYLSPVAVWQMLLARLLEQHYGLTLNDTPFSDETVIQEHIDAGISLADAVNFLVEKYGLARIDFRRF
DWQEQSPYLRAVDILRARQATGLLKRNRISAAR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|