Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | kacAT/DUF1778(antitoxin) |
| Location | 4660807..4661617 | Replicon | chromosome |
| Accession | NZ_CP099260 | ||
| Organism | Klebsiella aerogenes strain RHB08-SO-C04 | ||
Toxin (Protein)
| Gene name | KacT | Uniprot ID | - |
| Locus tag | NFJ54_RS22775 | Protein ID | WP_063444594.1 |
| Coordinates | 4660807..4661340 (-) | Length | 178 a.a. |
Antitoxin (Protein)
| Gene name | KacA | Uniprot ID | J2E9Q7 |
| Locus tag | NFJ54_RS22780 | Protein ID | WP_002887278.1 |
| Coordinates | 4661351..4661617 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFJ54_RS22770 (NFJ54_22740) | 4659639..4660760 | + | 1122 | WP_015704249.1 | cupin domain-containing protein | - |
| NFJ54_RS22775 (NFJ54_22745) | 4660807..4661340 | - | 534 | WP_063444594.1 | type II toxin-antitoxin system toxin KacT | Toxin |
| NFJ54_RS22780 (NFJ54_22750) | 4661351..4661617 | - | 267 | WP_002887278.1 | type II toxin-antitoxin system antitoxin KacA | Antitoxin |
| NFJ54_RS22785 (NFJ54_22755) | 4661696..4663153 | - | 1458 | WP_086557054.1 | Cu(+)/Ag(+) sensor histidine kinase | - |
| NFJ54_RS22790 (NFJ54_22760) | 4663143..4663826 | - | 684 | WP_008807068.1 | copper response regulator transcription factor CusR | - |
| NFJ54_RS22795 (NFJ54_22765) | 4664000..4665385 | + | 1386 | WP_227393476.1 | efflux transporter outer membrane subunit | - |
| NFJ54_RS22800 (NFJ54_22770) | 4665403..4665747 | + | 345 | WP_042894147.1 | cation efflux system protein CusF | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 178 a.a. Molecular weight: 19883.80 Da Isoelectric Point: 5.0044
>T248298 WP_063444594.1 NZ_CP099260:c4661340-4660807 [Klebsiella aerogenes]
MDQLLTIEMIADEFRYDITGFDCGEEALNTFLKEHLKRQHDGQILRGYALVSGDTVPMLLGYYTLSGSCFERGMLPSKTQ
QKKIPYQNAPSVTLGRLAIDKSVQGQGWGEMLVAHAMRVVWGASKAVGIYGLFVEALNEKAKAFYLRLGFIQLVDENSNL
LFYPTKSIEQLFTDDES
MDQLLTIEMIADEFRYDITGFDCGEEALNTFLKEHLKRQHDGQILRGYALVSGDTVPMLLGYYTLSGSCFERGMLPSKTQ
QKKIPYQNAPSVTLGRLAIDKSVQGQGWGEMLVAHAMRVVWGASKAVGIYGLFVEALNEKAKAFYLRLGFIQLVDENSNL
LFYPTKSIEQLFTDDES
Download Length: 534 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|