Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | ypjF-yeeU/CbtA-CbeA |
| Location | 4199918..4200663 | Replicon | chromosome |
| Accession | NZ_CP099260 | ||
| Organism | Klebsiella aerogenes strain RHB08-SO-C04 | ||
Toxin (Protein)
| Gene name | ypjF | Uniprot ID | - |
| Locus tag | NFJ54_RS20690 | Protein ID | WP_161398213.1 |
| Coordinates | 4200295..4200663 (+) | Length | 123 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | NFJ54_RS20685 | Protein ID | WP_024273779.1 |
| Coordinates | 4199918..4200274 (+) | Length | 119 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFJ54_RS20645 (NFJ54_20615) | 4194940..4195815 | + | 876 | WP_279281246.1 | GTPase family protein | - |
| NFJ54_RS20650 (NFJ54_20620) | 4196030..4196719 | + | 690 | WP_161398220.1 | transcriptional regulator | - |
| NFJ54_RS20655 (NFJ54_20625) | 4196740..4197213 | + | 474 | WP_248899593.1 | hypothetical protein | - |
| NFJ54_RS20660 (NFJ54_20630) | 4197239..4197703 | + | 465 | WP_161398218.1 | hypothetical protein | - |
| NFJ54_RS20665 (NFJ54_20635) | 4197824..4198645 | + | 822 | WP_161398217.1 | DUF932 domain-containing protein | - |
| NFJ54_RS20670 (NFJ54_20640) | 4198676..4199119 | + | 444 | WP_248899592.1 | antirestriction protein | - |
| NFJ54_RS20675 (NFJ54_20645) | 4199132..4199674 | + | 543 | WP_161398215.1 | DNA repair protein RadC | - |
| NFJ54_RS20680 (NFJ54_20650) | 4199671..4199892 | + | 222 | WP_161398214.1 | DUF987 family protein | - |
| NFJ54_RS20685 (NFJ54_20655) | 4199918..4200274 | + | 357 | WP_024273779.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| NFJ54_RS20690 (NFJ54_20660) | 4200295..4200663 | + | 369 | WP_161398213.1 | TA system toxin CbtA family protein | Toxin |
| NFJ54_RS20695 (NFJ54_20665) | 4201382..4201696 | + | 315 | WP_032705469.1 | DUF1493 family protein | - |
| NFJ54_RS20700 (NFJ54_20670) | 4201805..4202443 | - | 639 | WP_279281247.1 | helix-turn-helix domain-containing protein | - |
| NFJ54_RS20705 (NFJ54_20675) | 4202951..4204096 | - | 1146 | WP_116289604.1 | CMY2-MIR-ACT-EC family cephalosporin-hydrolyzing class C beta-lactamase | - |
| NFJ54_RS20710 (NFJ54_20680) | 4204239..4205129 | + | 891 | WP_045413093.1 | LysR family transcriptional regulator AmpR | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4174919..4201696 | 26777 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13667.91 Da Isoelectric Point: 8.7174
>T248297 WP_161398213.1 NZ_CP099260:4200295-4200663 [Klebsiella aerogenes]
MKNPPATISRAAKPCLSPVAVWQMLLTRLLEQHYGLMLSDTPFSDETVIKEHIDAGITLANAVNFLVEKYELVRIDRNGF
TSPVQAPYLTTTDILQARKACGLMSRCSYREVSNIVLSRSRL
MKNPPATISRAAKPCLSPVAVWQMLLTRLLEQHYGLMLSDTPFSDETVIKEHIDAGITLANAVNFLVEKYELVRIDRNGF
TSPVQAPYLTTTDILQARKACGLMSRCSYREVSNIVLSRSRL
Download Length: 369 bp
Antitoxin
Download Length: 119 a.a. Molecular weight: 13082.68 Da Isoelectric Point: 5.8720
>AT248297 WP_024273779.1 NZ_CP099260:4199918-4200274 [Klebsiella aerogenes]
MNNHSESGDKPENPACQQWGLKSTITPCFGARLVQEGNRVHFLADRAGFNGAFSDDDALHLDQVFPLILKQLELMLTSGE
LSSRHQHCVTLYHNGLTCEADTLGSCGYVYIAIYPTQR
MNNHSESGDKPENPACQQWGLKSTITPCFGARLVQEGNRVHFLADRAGFNGAFSDDDALHLDQVFPLILKQLELMLTSGE
LSSRHQHCVTLYHNGLTCEADTLGSCGYVYIAIYPTQR
Download Length: 357 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|