Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4014531..4015150 Replicon chromosome
Accession NZ_CP099260
Organism Klebsiella aerogenes strain RHB08-SO-C04

Toxin (Protein)


Gene name Hha Uniprot ID A0A0H3FXE2
Locus tag NFJ54_RS19730 Protein ID WP_015367918.1
Coordinates 4014932..4015150 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID A0A0H3FPM3
Locus tag NFJ54_RS19725 Protein ID WP_015367917.1
Coordinates 4014531..4014905 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NFJ54_RS19715 (NFJ54_19685) 4009690..4010889 + 1200 WP_020079451.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
NFJ54_RS19720 (NFJ54_19690) 4010912..4014058 + 3147 WP_015367916.1 multidrug efflux RND transporter permease subunit AcrB -
NFJ54_RS19725 (NFJ54_19695) 4014531..4014905 + 375 WP_015367917.1 Hha toxicity modulator TomB Antitoxin
NFJ54_RS19730 (NFJ54_19700) 4014932..4015150 + 219 WP_015367918.1 HHA domain-containing protein Toxin
NFJ54_RS19735 (NFJ54_19705) 4015282..4015845 + 564 WP_045361854.1 maltose O-acetyltransferase -
NFJ54_RS19740 (NFJ54_19710) 4015820..4015924 - 105 Protein_3873 hypothetical protein -
NFJ54_RS19745 (NFJ54_19715) 4015971..4016435 + 465 WP_015367920.1 YlaC family protein -
NFJ54_RS19750 (NFJ54_19720) 4016410..4017864 - 1455 WP_020079453.1 PLP-dependent aminotransferase family protein -
NFJ54_RS19755 (NFJ54_19725) 4017967..4018677 + 711 WP_032713998.1 GNAT family protein -
NFJ54_RS19760 (NFJ54_19730) 4018674..4018814 - 141 WP_003859006.1 type B 50S ribosomal protein L36 -
NFJ54_RS19765 (NFJ54_19735) 4018817..4019077 - 261 WP_015367923.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8569.96 Da        Isoelectric Point: 9.4828

>T248296 WP_015367918.1 NZ_CP099260:4014932-4015150 [Klebsiella aerogenes]
MSGKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14464.21 Da        Isoelectric Point: 4.9045

>AT248296 WP_015367917.1 NZ_CP099260:4014531-4014905 [Klebsiella aerogenes]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNRGWVNDPTSAVNLQLNELIEHIATYALNYKIKYAEDNKLISQLDEYL
DDTFMLFSSYGINTSDLQKWRKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3FXE2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3FPM3

References