Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 4014531..4015150 | Replicon | chromosome |
| Accession | NZ_CP099260 | ||
| Organism | Klebsiella aerogenes strain RHB08-SO-C04 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | A0A0H3FXE2 |
| Locus tag | NFJ54_RS19730 | Protein ID | WP_015367918.1 |
| Coordinates | 4014932..4015150 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | A0A0H3FPM3 |
| Locus tag | NFJ54_RS19725 | Protein ID | WP_015367917.1 |
| Coordinates | 4014531..4014905 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFJ54_RS19715 (NFJ54_19685) | 4009690..4010889 | + | 1200 | WP_020079451.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| NFJ54_RS19720 (NFJ54_19690) | 4010912..4014058 | + | 3147 | WP_015367916.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| NFJ54_RS19725 (NFJ54_19695) | 4014531..4014905 | + | 375 | WP_015367917.1 | Hha toxicity modulator TomB | Antitoxin |
| NFJ54_RS19730 (NFJ54_19700) | 4014932..4015150 | + | 219 | WP_015367918.1 | HHA domain-containing protein | Toxin |
| NFJ54_RS19735 (NFJ54_19705) | 4015282..4015845 | + | 564 | WP_045361854.1 | maltose O-acetyltransferase | - |
| NFJ54_RS19740 (NFJ54_19710) | 4015820..4015924 | - | 105 | Protein_3873 | hypothetical protein | - |
| NFJ54_RS19745 (NFJ54_19715) | 4015971..4016435 | + | 465 | WP_015367920.1 | YlaC family protein | - |
| NFJ54_RS19750 (NFJ54_19720) | 4016410..4017864 | - | 1455 | WP_020079453.1 | PLP-dependent aminotransferase family protein | - |
| NFJ54_RS19755 (NFJ54_19725) | 4017967..4018677 | + | 711 | WP_032713998.1 | GNAT family protein | - |
| NFJ54_RS19760 (NFJ54_19730) | 4018674..4018814 | - | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
| NFJ54_RS19765 (NFJ54_19735) | 4018817..4019077 | - | 261 | WP_015367923.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8569.96 Da Isoelectric Point: 9.4828
>T248296 WP_015367918.1 NZ_CP099260:4014932-4015150 [Klebsiella aerogenes]
MSGKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSGKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14464.21 Da Isoelectric Point: 4.9045
>AT248296 WP_015367917.1 NZ_CP099260:4014531-4014905 [Klebsiella aerogenes]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNRGWVNDPTSAVNLQLNELIEHIATYALNYKIKYAEDNKLISQLDEYL
DDTFMLFSSYGINTSDLQKWRKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNRGWVNDPTSAVNLQLNELIEHIATYALNYKIKYAEDNKLISQLDEYL
DDTFMLFSSYGINTSDLQKWRKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3FXE2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3FPM3 |