Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 2618401..2619140 | Replicon | chromosome |
| Accession | NZ_CP099260 | ||
| Organism | Klebsiella aerogenes strain RHB08-SO-C04 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | - |
| Locus tag | NFJ54_RS12785 | Protein ID | WP_279281548.1 |
| Coordinates | 2618655..2619140 (+) | Length | 162 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | A0A0H3FSM9 |
| Locus tag | NFJ54_RS12780 | Protein ID | WP_015705366.1 |
| Coordinates | 2618401..2618667 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFJ54_RS12755 (NFJ54_12735) | 2613736..2614323 | + | 588 | WP_100279812.1 | hypothetical protein | - |
| NFJ54_RS12760 (NFJ54_12740) | 2614320..2615639 | + | 1320 | WP_279281547.1 | ATP-binding protein | - |
| NFJ54_RS12765 (NFJ54_12745) | 2615639..2616256 | + | 618 | WP_045360840.1 | response regulator | - |
| NFJ54_RS12770 (NFJ54_12750) | 2616352..2616849 | + | 498 | WP_015705368.1 | heme-binding protein | - |
| NFJ54_RS12775 (NFJ54_12755) | 2616893..2618128 | - | 1236 | WP_020078885.1 | MFS transporter | - |
| NFJ54_RS12780 (NFJ54_12760) | 2618401..2618667 | + | 267 | WP_015705366.1 | DUF1778 domain-containing protein | Antitoxin |
| NFJ54_RS12785 (NFJ54_12765) | 2618655..2619140 | + | 486 | WP_279281548.1 | GNAT family N-acetyltransferase | Toxin |
| NFJ54_RS12790 (NFJ54_12770) | 2619212..2620828 | + | 1617 | WP_032711617.1 | FAD-NAD(P)-binding protein | - |
| NFJ54_RS12795 (NFJ54_12775) | 2620947..2622047 | + | 1101 | WP_015705363.1 | NADH:flavin oxidoreductase/NADH oxidase | - |
| NFJ54_RS12800 (NFJ54_12780) | 2622104..2622262 | - | 159 | WP_002903230.1 | YqaE/Pmp3 family membrane protein | - |
| NFJ54_RS12805 (NFJ54_12785) | 2622523..2623593 | + | 1071 | WP_015705361.1 | mannonate dehydratase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17633.28 Da Isoelectric Point: 8.8590
>T248295 WP_279281548.1 NZ_CP099260:2618655-2619140 [Klebsiella aerogenes]
MGKISAPTPLSSHHQIAEFCCGETVLDQWLKQRGLKNQAQGAARTFVVCKEESHQVVGFYSLATGSVNHTEATGGLRRNM
PDPIPVIILARLAIDCAYHGQGLGADLLHDALLRSYRVAENVGVRALMVHALTDSAKRFYLHHGFKASTTQERTLFLALP
K
MGKISAPTPLSSHHQIAEFCCGETVLDQWLKQRGLKNQAQGAARTFVVCKEESHQVVGFYSLATGSVNHTEATGGLRRNM
PDPIPVIILARLAIDCAYHGQGLGADLLHDALLRSYRVAENVGVRALMVHALTDSAKRFYLHHGFKASTTQERTLFLALP
K
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|