Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/- |
Location | 264281..264912 | Replicon | chromosome |
Accession | NZ_CP099260 | ||
Organism | Klebsiella aerogenes strain RHB08-SO-C04 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A0H3FL31 |
Locus tag | NFJ54_RS01205 | Protein ID | WP_015703741.1 |
Coordinates | 264281..264556 (+) | Length | 92 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | A0A0H3FNK6 |
Locus tag | NFJ54_RS01210 | Protein ID | WP_015703740.1 |
Coordinates | 264553..264912 (+) | Length | 120 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFJ54_RS01185 (NFJ54_01185) | 259510..259845 | + | 336 | WP_015703743.1 | universal stress protein UspB | - |
NFJ54_RS01190 (NFJ54_01190) | 259910..261406 | - | 1497 | WP_015369272.1 | inorganic phosphate transporter PitA | - |
NFJ54_RS01195 (NFJ54_01195) | 261637..262830 | + | 1194 | WP_048229922.1 | NAD(P)/FAD-dependent oxidoreductase | - |
NFJ54_RS01200 (NFJ54_01200) | 262871..263884 | - | 1014 | WP_015369274.1 | magnesium transporter | - |
NFJ54_RS01205 (NFJ54_01205) | 264281..264556 | + | 276 | WP_015703741.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
NFJ54_RS01210 (NFJ54_01210) | 264553..264912 | + | 360 | WP_015703740.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
NFJ54_RS01215 (NFJ54_01215) | 264940..265341 | - | 402 | WP_020077744.1 | nickel-responsive transcriptional regulator NikR | - |
NFJ54_RS01220 (NFJ54_01220) | 265329..266120 | - | 792 | WP_032715259.1 | nickel import ATP-binding protein NikE | - |
NFJ54_RS01225 (NFJ54_01225) | 266117..266881 | - | 765 | WP_015369277.1 | nickel import ATP-binding protein NikD | - |
NFJ54_RS01230 (NFJ54_01230) | 266881..267714 | - | 834 | WP_279281327.1 | nickel ABC transporter permease subunit NikC | - |
NFJ54_RS01235 (NFJ54_01235) | 267711..268655 | - | 945 | WP_045413435.1 | nickel ABC transporter permease subunit NikB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10258.89 Da Isoelectric Point: 10.4888
>T248288 WP_015703741.1 NZ_CP099260:264281-264556 [Klebsiella aerogenes]
MEQQVLSLRKKQRNTLEQLFKTPVPQGIKWADIESLIKALGGEIKEGRGSRCKFLLNHSIASFHRPHPSPDTDKGAVESV
RDWLITIGVKP
MEQQVLSLRKKQRNTLEQLFKTPVPQGIKWADIESLIKALGGEIKEGRGSRCKFLLNHSIASFHRPHPSPDTDKGAVESV
RDWLITIGVKP
Download Length: 276 bp
Antitoxin
Download Length: 120 a.a. Molecular weight: 13305.02 Da Isoelectric Point: 4.3472
>AT248288 WP_015703740.1 NZ_CP099260:264553-264912 [Klebsiella aerogenes]
MIKPKTPNSMEIAGQPAVINYVPELNAFRGKFLGLSGYCDFVSDSIQGLQQEGEISLQEYLADCREAGIEPYAQPEKLKT
FTLRYPESFGERLSSAAAEEQVSVNTWILETLNERLKQA
MIKPKTPNSMEIAGQPAVINYVPELNAFRGKFLGLSGYCDFVSDSIQGLQQEGEISLQEYLADCREAGIEPYAQPEKLKT
FTLRYPESFGERLSSAAAEEQVSVNTWILETLNERLKQA
Download Length: 360 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3FL31 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3FNK6 |