Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PP_4151-4152/excise(antitoxin) |
Location | 76657..77678 | Replicon | chromosome |
Accession | NZ_CP099260 | ||
Organism | Klebsiella aerogenes strain RHB08-SO-C04 |
Toxin (Protein)
Gene name | PP_4152 | Uniprot ID | A0A0G9UXE3 |
Locus tag | NFJ54_RS00395 | Protein ID | WP_032706547.1 |
Coordinates | 77103..77678 (+) | Length | 192 a.a. |
Antitoxin (Protein)
Gene name | PP_4151 | Uniprot ID | - |
Locus tag | NFJ54_RS00390 | Protein ID | WP_279281318.1 |
Coordinates | 76657..77103 (+) | Length | 149 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFJ54_RS00365 (NFJ54_00365) | 72178..72957 | + | 780 | WP_058676322.1 | MBL fold metallo-hydrolase | - |
NFJ54_RS00370 (NFJ54_00370) | 72979..73932 | + | 954 | WP_058676358.1 | helix-turn-helix domain-containing protein | - |
NFJ54_RS00375 (NFJ54_00375) | 73929..74978 | - | 1050 | WP_279281317.1 | NAD(P)-dependent alcohol dehydrogenase | - |
NFJ54_RS00380 (NFJ54_00380) | 75136..75438 | - | 303 | WP_045390549.1 | putative quinol monooxygenase | - |
NFJ54_RS00385 (NFJ54_00385) | 75439..76446 | - | 1008 | WP_042893659.1 | zinc-binding alcohol dehydrogenase family protein | - |
NFJ54_RS00390 (NFJ54_00390) | 76657..77103 | + | 447 | WP_279281318.1 | helix-turn-helix domain-containing protein | Antitoxin |
NFJ54_RS00395 (NFJ54_00395) | 77103..77678 | + | 576 | WP_032706547.1 | PIN domain-containing protein | Toxin |
NFJ54_RS00400 (NFJ54_00400) | 77983..79179 | + | 1197 | WP_042893658.1 | hypothetical protein | - |
NFJ54_RS00405 (NFJ54_00405) | 79462..80499 | - | 1038 | WP_045411414.1 | virulence RhuM family protein | - |
NFJ54_RS00410 (NFJ54_00410) | 80734..81022 | - | 289 | Protein_81 | SymE family type I addiction module toxin | - |
NFJ54_RS00415 (NFJ54_00415) | 81094..81396 | - | 303 | WP_020077664.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 192 a.a. Molecular weight: 21688.29 Da Isoelectric Point: 6.2900
>T248287 WP_032706547.1 NZ_CP099260:77103-77678 [Klebsiella aerogenes]
MRHSPYPVILDACVLYPARLRDLLMHLGIAGLYQPKWSRFIHDEWCRNLLINRPDIAPEALRRTVDLMNAALPDANVTGF
AGLINGLVLPDPDDRHVLAAAIRAKAEIIVTLNHKDFPAESLLPFEIETLHPDVFISDLFDLNHALALEAVRRQRQSLKH
PPMTVDEFLEMLLKQGLPMTVKELANYQYAI
MRHSPYPVILDACVLYPARLRDLLMHLGIAGLYQPKWSRFIHDEWCRNLLINRPDIAPEALRRTVDLMNAALPDANVTGF
AGLINGLVLPDPDDRHVLAAAIRAKAEIIVTLNHKDFPAESLLPFEIETLHPDVFISDLFDLNHALALEAVRRQRQSLKH
PPMTVDEFLEMLLKQGLPMTVKELANYQYAI
Download Length: 576 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16697.33 Da Isoelectric Point: 7.0630
>AT248287 WP_279281318.1 NZ_CP099260:76657-77103 [Klebsiella aerogenes]
MTKLNLPNPLESELAQRGQRELAAYLSTHLKTQRIAIVGEDDKTHTIELPTSALTMLMEILGELACGNAVQIVPVHAELT
TQEAANILNVSRPHMVKLLEARKLPFHKTGRHRRVLFADLMEYKKRREQESLDAMQALADQAQDLGMY
MTKLNLPNPLESELAQRGQRELAAYLSTHLKTQRIAIVGEDDKTHTIELPTSALTMLMEILGELACGNAVQIVPVHAELT
TQEAANILNVSRPHMVKLLEARKLPFHKTGRHRRVLFADLMEYKKRREQESLDAMQALADQAQDLGMY
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|