Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-YafN |
Location | 4463345..4463880 | Replicon | chromosome |
Accession | NZ_CP099254 | ||
Organism | Citrobacter freundii strain RHB09-E3-C07 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | NFJ59_RS21025 | Protein ID | WP_279277372.1 |
Coordinates | 4463593..4463880 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | NFJ59_RS21020 | Protein ID | WP_137399198.1 |
Coordinates | 4463345..4463596 (+) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFJ59_RS20990 (4458838) | 4458838..4459596 | + | 759 | WP_182270582.1 | phosphonate C-P lyase system protein PhnK | - |
NFJ59_RS20995 (4459703) | 4459703..4460383 | + | 681 | WP_182270583.1 | phosphonate C-P lyase system protein PhnL | - |
NFJ59_RS21000 (4460380) | 4460380..4461516 | + | 1137 | WP_182270584.1 | alpha-D-ribose 1-methylphosphonate 5-triphosphate diphosphatase | - |
NFJ59_RS21005 (4461519) | 4461519..4462073 | + | 555 | WP_182270585.1 | ribose 1,5-bisphosphokinase | - |
NFJ59_RS21010 (4462060) | 4462060..4462494 | + | 435 | WP_182270586.1 | aminoalkylphosphonate N-acetyltransferase | - |
NFJ59_RS21015 (4462503) | 4462503..4463261 | + | 759 | WP_182270587.1 | phosphonate metabolism protein PhnP | - |
NFJ59_RS21020 (4463345) | 4463345..4463596 | + | 252 | WP_137399198.1 | antitoxin | Antitoxin |
NFJ59_RS21025 (4463593) | 4463593..4463880 | + | 288 | WP_279277372.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NFJ59_RS21030 (4463877) | 4463877..4464206 | - | 330 | WP_279277373.1 | DDRRRQL repeat protein YjdP | - |
NFJ59_RS21035 (4464276) | 4464276..4466540 | - | 2265 | WP_279277374.1 | hybrid sensor histidine kinase/response regulator | - |
NFJ59_RS21040 (4466655) | 4466655..4468178 | + | 1524 | WP_279277375.1 | sugar ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11072.98 Da Isoelectric Point: 10.4701
>T248284 WP_279277372.1 NZ_CP099254:4463593-4463880 [Citrobacter freundii]
MSYTVKFREDALKEWQKLDKTIQQQFAKKLKKCGENPHVPSAKLRGIKDCYKIKLRTSGFRLVYQVIDDTLVIAVVAVGK
RERSEVYNLASERLR
MSYTVKFREDALKEWQKLDKTIQQQFAKKLKKCGENPHVPSAKLRGIKDCYKIKLRTSGFRLVYQVIDDTLVIAVVAVGK
RERSEVYNLASERLR
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|