Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
Location | 4174714..4175290 | Replicon | chromosome |
Accession | NZ_CP099254 | ||
Organism | Citrobacter freundii strain RHB09-E3-C07 |
Toxin (Protein)
Gene name | shpA | Uniprot ID | - |
Locus tag | NFJ59_RS19735 | Protein ID | WP_117342369.1 |
Coordinates | 4175003..4175290 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | shpB | Uniprot ID | - |
Locus tag | NFJ59_RS19730 | Protein ID | WP_117342368.1 |
Coordinates | 4174714..4175016 (-) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFJ59_RS19715 (4171173) | 4171173..4173323 | + | 2151 | WP_135912629.1 | pyruvate/proton symporter BtsT | - |
NFJ59_RS19720 (4173440) | 4173440..4173634 | + | 195 | WP_003830038.1 | YbdD/YjiX family protein | - |
NFJ59_RS19725 (4173647) | 4173647..4174603 | + | 957 | WP_096758431.1 | GTPase | - |
NFJ59_RS19730 (4174714) | 4174714..4175016 | - | 303 | WP_117342368.1 | BrnA antitoxin family protein | Antitoxin |
NFJ59_RS19735 (4175003) | 4175003..4175290 | - | 288 | WP_117342369.1 | BrnT family toxin | Toxin |
NFJ59_RS19740 (4175463) | 4175463..4175627 | - | 165 | WP_279277307.1 | DUF1127 domain-containing protein | - |
NFJ59_RS19745 (4175804) | 4175804..4177216 | + | 1413 | WP_279277308.1 | PLP-dependent aminotransferase family protein | - |
NFJ59_RS19750 (4177243) | 4177243..4177908 | - | 666 | Protein_3866 | Rpn family recombination-promoting nuclease/putative transposase | - |
NFJ59_RS19755 (4178345) | 4178345..4179586 | + | 1242 | WP_279277309.1 | multidrug efflux MFS transporter MdtM | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11362.75 Da Isoelectric Point: 7.5239
>T248283 WP_117342369.1 NZ_CP099254:c4175290-4175003 [Citrobacter freundii]
MPMEFEWDANKAQSNHRKHGVRFEDAVLVFDDPRHLSRQDRYENGEYRWQTIGLVHGIVVILVAHSVRFESGFEVIRIIS
ARKADRKERNRYEHD
MPMEFEWDANKAQSNHRKHGVRFEDAVLVFDDPRHLSRQDRYENGEYRWQTIGLVHGIVVILVAHSVRFESGFEVIRIIS
ARKADRKERNRYEHD
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|