Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3650122..3650742 | Replicon | chromosome |
Accession | NZ_CP099254 | ||
Organism | Citrobacter freundii strain RHB09-E3-C07 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | R8WYV2 |
Locus tag | NFJ59_RS17410 | Protein ID | WP_002892050.1 |
Coordinates | 3650524..3650742 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | - |
Locus tag | NFJ59_RS17405 | Protein ID | WP_115259201.1 |
Coordinates | 3650122..3650496 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFJ59_RS17395 (3645268) | 3645268..3646461 | + | 1194 | WP_096758038.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
NFJ59_RS17400 (3646484) | 3646484..3649633 | + | 3150 | WP_096758039.1 | efflux RND transporter permease AcrB | - |
NFJ59_RS17405 (3650122) | 3650122..3650496 | + | 375 | WP_115259201.1 | Hha toxicity modulator TomB | Antitoxin |
NFJ59_RS17410 (3650524) | 3650524..3650742 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
NFJ59_RS17415 (3651124) | 3651124..3651597 | + | 474 | WP_181618814.1 | YlaC family protein | - |
NFJ59_RS17420 (3651671) | 3651671..3651811 | - | 141 | WP_005125190.1 | type B 50S ribosomal protein L36 | - |
NFJ59_RS17425 (3651813) | 3651813..3652073 | - | 261 | WP_115259215.1 | type B 50S ribosomal protein L31 | - |
NFJ59_RS17430 (3652258) | 3652258..3653811 | + | 1554 | WP_181618813.1 | EAL domain-containing protein | - |
NFJ59_RS17435 (3653865) | 3653865..3654218 | - | 354 | WP_115259217.1 | DUF1428 family protein | - |
NFJ59_RS17440 (3654301) | 3654301..3654912 | - | 612 | WP_115259218.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T248282 WP_002892050.1 NZ_CP099254:3650524-3650742 [Citrobacter freundii]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14454.26 Da Isoelectric Point: 5.5653
>AT248282 WP_115259201.1 NZ_CP099254:3650122-3650496 [Citrobacter freundii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSNYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSNYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|