Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 2462334..2463103 | Replicon | chromosome |
| Accession | NZ_CP099254 | ||
| Organism | Citrobacter freundii strain RHB09-E3-C07 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | - |
| Locus tag | NFJ59_RS11665 | Protein ID | WP_279276842.1 |
| Coordinates | 2462621..2463103 (+) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | - |
| Locus tag | NFJ59_RS11660 | Protein ID | WP_168246960.1 |
| Coordinates | 2462334..2462630 (+) | Length | 99 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFJ59_RS11645 (2458674) | 2458674..2459303 | + | 630 | WP_181619409.1 | winged helix-turn-helix transcriptional regulator | - |
| NFJ59_RS11650 (2459413) | 2459413..2460030 | + | 618 | WP_181619408.1 | outer membrane beta-barrel protein | - |
| NFJ59_RS11655 (2460239) | 2460239..2462221 | + | 1983 | WP_279276841.1 | alkyl sulfatase dimerization domain-containing protein | - |
| NFJ59_RS11660 (2462334) | 2462334..2462630 | + | 297 | WP_168246960.1 | DUF1778 domain-containing protein | Antitoxin |
| NFJ59_RS11665 (2462621) | 2462621..2463103 | + | 483 | WP_279276842.1 | GNAT family N-acetyltransferase | Toxin |
| NFJ59_RS11670 (2463113) | 2463113..2463419 | - | 307 | Protein_2288 | NAD(P)H-binding protein | - |
| NFJ59_RS11675 (2463568) | 2463568..2464461 | + | 894 | WP_279276843.1 | LysR family transcriptional regulator | - |
| NFJ59_RS11680 (2464486) | 2464486..2465474 | - | 989 | Protein_2290 | aldo/keto reductase | - |
| NFJ59_RS11685 (2465498) | 2465498..2466349 | - | 852 | WP_279276844.1 | aldo/keto reductase | - |
| NFJ59_RS11690 (2466629) | 2466629..2467501 | + | 873 | WP_279276845.1 | aldo/keto reductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17702.31 Da Isoelectric Point: 7.2887
>T248281 WP_279276842.1 NZ_CP099254:2462621-2463103 [Citrobacter freundii]
MEINVTAPALLTEGHELQPFDCGNEVLNDWLCRRAIKNQYINASRTFVICLESTQRVVGYYSIATGSVSHADLGRSLRQN
MPDPVPVVLLGRLAVDASTQGHSFGKWLLNDAVLRISNLADQVGIKAIMVHAIDGKARAFYEYYGFVQSPIAANTLFYKI
MEINVTAPALLTEGHELQPFDCGNEVLNDWLCRRAIKNQYINASRTFVICLESTQRVVGYYSIATGSVSHADLGRSLRQN
MPDPVPVVLLGRLAVDASTQGHSFGKWLLNDAVLRISNLADQVGIKAIMVHAIDGKARAFYEYYGFVQSPIAANTLFYKI
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|