Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 932469..933114 | Replicon | chromosome |
Accession | NZ_CP099254 | ||
Organism | Citrobacter freundii strain RHB09-E3-C07 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | - |
Locus tag | NFJ59_RS04605 | Protein ID | WP_181617795.1 |
Coordinates | 932716..933114 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | - |
Locus tag | NFJ59_RS04600 | Protein ID | WP_181617796.1 |
Coordinates | 932469..932735 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFJ59_RS04575 (927684) | 927684..929117 | - | 1434 | WP_181617800.1 | 6-phospho-beta-glucosidase BglA | - |
NFJ59_RS04580 (929238) | 929238..929966 | - | 729 | WP_115259901.1 | MurR/RpiR family transcriptional regulator | - |
NFJ59_RS04585 (930019) | 930019..930330 | + | 312 | WP_279277715.1 | N(4)-acetylcytidine aminohydrolase | - |
NFJ59_RS04590 (930494) | 930494..931153 | + | 660 | WP_096755796.1 | hemolysin III family protein | - |
NFJ59_RS04595 (931233) | 931233..932213 | - | 981 | WP_181617797.1 | tRNA-modifying protein YgfZ | - |
NFJ59_RS04600 (932469) | 932469..932735 | + | 267 | WP_181617796.1 | FAD assembly factor SdhE | Antitoxin |
NFJ59_RS04605 (932716) | 932716..933114 | + | 399 | WP_181617795.1 | protein YgfX | Toxin |
NFJ59_RS04610 (933160) | 933160..933681 | - | 522 | WP_181617794.1 | flavodoxin FldB | - |
NFJ59_RS04615 (933794) | 933794..934690 | + | 897 | WP_181617793.1 | site-specific tyrosine recombinase XerD | - |
NFJ59_RS04620 (934714) | 934714..935427 | + | 714 | WP_181617792.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
NFJ59_RS04625 (935433) | 935433..937166 | + | 1734 | WP_279277716.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15634.57 Da Isoelectric Point: 11.2851
>T248275 WP_181617795.1 NZ_CP099254:932716-933114 [Citrobacter freundii]
VVQWQSDLRVSWRAQWISLLIHGLVAVLILLMPWPLSYTPLWLILLSLVVFDCVRSQRRINACQGEIRLLMDGRLRWQGQ
EWTIVSAPWMIKTGMMLRLRSSTGKRQHLWLAADSMDDAEWRDLRRLILQQK
VVQWQSDLRVSWRAQWISLLIHGLVAVLILLMPWPLSYTPLWLILLSLVVFDCVRSQRRINACQGEIRLLMDGRLRWQGQ
EWTIVSAPWMIKTGMMLRLRSSTGKRQHLWLAADSMDDAEWRDLRRLILQQK
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|