Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
| Location | 309671..310257 | Replicon | chromosome |
| Accession | NZ_CP099254 | ||
| Organism | Citrobacter freundii strain RHB09-E3-C07 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | - |
| Locus tag | NFJ59_RS01525 | Protein ID | WP_181618387.1 |
| Coordinates | 309889..310257 (+) | Length | 123 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | - |
| Locus tag | NFJ59_RS01520 | Protein ID | WP_096759232.1 |
| Coordinates | 309671..309892 (+) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFJ59_RS01495 (304728) | 304728..305837 | + | 1110 | WP_279277560.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
| NFJ59_RS01500 (305885) | 305885..306811 | + | 927 | WP_096759229.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
| NFJ59_RS01505 (306808) | 306808..308088 | + | 1281 | WP_279277561.1 | branched chain amino acid ABC transporter permease LivM | - |
| NFJ59_RS01510 (308085) | 308085..308852 | + | 768 | WP_096759231.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
| NFJ59_RS01515 (308870) | 308870..309583 | + | 714 | WP_096759502.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF | - |
| NFJ59_RS01520 (309671) | 309671..309892 | + | 222 | WP_096759232.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| NFJ59_RS01525 (309889) | 309889..310257 | + | 369 | WP_181618387.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| NFJ59_RS01530 (310509) | 310509..311825 | + | 1317 | WP_181618388.1 | sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB | - |
| NFJ59_RS01535 (311930) | 311930..312817 | + | 888 | WP_096759234.1 | sn-glycerol-3-phosphate ABC transporter permease UgpA | - |
| NFJ59_RS01540 (312814) | 312814..313659 | + | 846 | WP_115257274.1 | sn-glycerol-3-phosphate ABC transporter permease UgpE | - |
| NFJ59_RS01545 (313661) | 313661..314731 | + | 1071 | WP_174361254.1 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 306808..315471 | 8663 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13669.86 Da Isoelectric Point: 7.4033
>T248273 WP_181618387.1 NZ_CP099254:309889-310257 [Citrobacter freundii]
MTLQNISAEEIIQFHDRLLRVTPGVTGMPDPGRTEALMYRVLNQIEYEGVTDVWLPAAMHLLTISRGHIFNDGNKRTALF
ITLLFLKRNGIALSANPDFVAMTVEAAAGRLSLEQIAHRLRQ
MTLQNISAEEIIQFHDRLLRVTPGVTGMPDPGRTEALMYRVLNQIEYEGVTDVWLPAAMHLLTISRGHIFNDGNKRTALF
ITLLFLKRNGIALSANPDFVAMTVEAAAGRLSLEQIAHRLRQ
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|