Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 66957..67676 Replicon chromosome
Accession NZ_CP099254
Organism Citrobacter freundii strain RHB09-E3-C07

Toxin (Protein)


Gene name yeeV Uniprot ID -
Locus tag NFJ59_RS00355 Protein ID WP_096080170.1
Coordinates 66957..67277 (-) Length 107 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID -
Locus tag NFJ59_RS00360 Protein ID WP_096080169.1
Coordinates 67311..67676 (-) Length 122 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NFJ59_RS00315 (63301) 63301..63633 - 333 WP_115257149.1 DUF1493 family protein -
NFJ59_RS00320 (63627) 63627..64070 - 444 WP_115257150.1 hypothetical protein -
NFJ59_RS00325 (64081) 64081..64566 - 486 WP_117342570.1 Hcp family type VI secretion system effector -
NFJ59_RS00330 (64783) 64783..65085 - 303 WP_181618266.1 type II toxin-antitoxin system RelE/ParE family toxin -
NFJ59_RS00335 (65089) 65089..65349 - 261 WP_032940654.1 type II toxin-antitoxin system prevent-host-death family antitoxin -
NFJ59_RS00340 (65523) 65523..65814 - 292 Protein_67 SymE family type I addiction module toxin -
NFJ59_RS00345 (65950) 65950..66144 + 195 WP_181540234.1 toxin-antitoxin system HicB family antitoxin -
NFJ59_RS00350 (66153) 66153..66719 - 567 WP_181540235.1 hypothetical protein -
NFJ59_RS00355 (66957) 66957..67277 - 321 WP_096080170.1 TA system toxin CbtA family protein Toxin
NFJ59_RS00360 (67311) 67311..67676 - 366 WP_096080169.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
NFJ59_RS00365 (67708) 67708..67929 - 222 WP_096080168.1 DUF987 domain-containing protein -
NFJ59_RS00370 (67938) 67938..68408 - 471 WP_096080167.1 DNA repair protein RadC -
NFJ59_RS00375 (68479) 68479..69300 - 822 WP_096080166.1 DUF932 domain-containing protein -
NFJ59_RS00380 (69375) 69375..69803 - 429 WP_096080165.1 hypothetical protein -
NFJ59_RS00385 (69839) 69839..70018 - 180 WP_096080164.1 hypothetical protein -
NFJ59_RS00390 (70069) 70069..70872 - 804 WP_279277489.1 hypothetical protein -
NFJ59_RS00395 (70892) 70892..71326 - 435 WP_144131960.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(5-104)

Antitoxin

Antitoxin CbeA

(18-116)


Sequences

Toxin        


Download         Length: 107 a.a.        Molecular weight: 12216.77 Da        Isoelectric Point: 6.2076

>T248272 WP_096080170.1 NZ_CP099254:c67277-66957 [Citrobacter freundii]
MHISTVPATVTVSSRLSPVQVWQKLLTYILEHHYGLTINDTPFSNDTTIQEHIEAGVNLTDAVNFLVERFDLVRIDQKGF
SWQDQEHWITSLDVHRAQFNLGLKRS

Download         Length: 321 bp

Antitoxin


Download         Length: 122 a.a.        Molecular weight: 13546.27 Da        Isoelectric Point: 6.8425

>AT248272 WP_096080169.1 NZ_CP099254:c67676-67311 [Citrobacter freundii]
MQSTTLSGSSTENASCLQWGLKRNIKPCFGARLVQEGNRLYFLTDRAGFDGSFSDDEALRLDQAFPLMMKQLERMLTTGE
LDPRSQHCVTRHHNGLTCEADTLGSHGYVYIAIYPQSALTR

Download         Length: 366 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References