Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4698799..4699315 | Replicon | chromosome |
| Accession | NZ_CP099252 | ||
| Organism | Klebsiella aerogenes strain RHB11-E1-C08 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | NFJ68_RS22705 | Protein ID | WP_046883307.1 |
| Coordinates | 4698799..4699083 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | R4Y888 |
| Locus tag | NFJ68_RS22710 | Protein ID | WP_002886901.1 |
| Coordinates | 4699073..4699315 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFJ68_RS22685 (NFJ68_22655) | 4694214..4694477 | - | 264 | WP_015368564.1 | PTS sugar transporter subunit IIB | - |
| NFJ68_RS22690 (NFJ68_22660) | 4694784..4695527 | + | 744 | WP_015704205.1 | MurR/RpiR family transcriptional regulator | - |
| NFJ68_RS22695 (NFJ68_22665) | 4695885..4698023 | + | 2139 | WP_015368566.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| NFJ68_RS22700 (NFJ68_22670) | 4698331..4698795 | + | 465 | WP_015368567.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| NFJ68_RS22705 (NFJ68_22675) | 4698799..4699083 | - | 285 | WP_046883307.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NFJ68_RS22710 (NFJ68_22680) | 4699073..4699315 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| NFJ68_RS22715 (NFJ68_22685) | 4699393..4701303 | - | 1911 | WP_045364915.1 | PRD domain-containing protein | - |
| NFJ68_RS22720 (NFJ68_22690) | 4701326..4702477 | - | 1152 | WP_020079795.1 | lactonase family protein | - |
| NFJ68_RS22725 (NFJ68_22695) | 4702544..4703284 | - | 741 | WP_015368570.1 | KDGP aldolase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11179.07 Da Isoelectric Point: 10.4951
>T248270 WP_046883307.1 NZ_CP099252:c4699083-4698799 [Klebsiella aerogenes]
MTYELEFDPRAWREWQKLGETVKKQFKNKLQQIVQNPRMESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYRQANKRL
MTYELEFDPRAWREWQKLGETVKKQFKNKLQQIVQNPRMESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYRQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|