Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | kacAT/DUF1778(antitoxin) |
| Location | 4598631..4599441 | Replicon | chromosome |
| Accession | NZ_CP099252 | ||
| Organism | Klebsiella aerogenes strain RHB11-E1-C08 | ||
Toxin (Protein)
| Gene name | KacT | Uniprot ID | - |
| Locus tag | NFJ68_RS22265 | Protein ID | WP_116289496.1 |
| Coordinates | 4598631..4599164 (-) | Length | 178 a.a. |
Antitoxin (Protein)
| Gene name | KacA | Uniprot ID | J2E9Q7 |
| Locus tag | NFJ68_RS22270 | Protein ID | WP_002887278.1 |
| Coordinates | 4599175..4599441 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFJ68_RS22260 (NFJ68_22230) | 4597463..4598584 | + | 1122 | WP_015704249.1 | cupin domain-containing protein | - |
| NFJ68_RS22265 (NFJ68_22235) | 4598631..4599164 | - | 534 | WP_116289496.1 | type II toxin-antitoxin system toxin KacT | Toxin |
| NFJ68_RS22270 (NFJ68_22240) | 4599175..4599441 | - | 267 | WP_002887278.1 | type II toxin-antitoxin system antitoxin KacA | Antitoxin |
| NFJ68_RS22275 (NFJ68_22245) | 4599520..4600977 | - | 1458 | WP_086557054.1 | Cu(+)/Ag(+) sensor histidine kinase | - |
| NFJ68_RS22280 (NFJ68_22250) | 4600967..4601650 | - | 684 | WP_008807068.1 | copper response regulator transcription factor CusR | - |
| NFJ68_RS22285 (NFJ68_22255) | 4601824..4603209 | + | 1386 | WP_042894144.1 | efflux transporter outer membrane subunit | - |
| NFJ68_RS22290 (NFJ68_22260) | 4603227..4603571 | + | 345 | WP_042894147.1 | cation efflux system protein CusF | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 178 a.a. Molecular weight: 19936.85 Da Isoelectric Point: 5.7150
>T248268 WP_116289496.1 NZ_CP099252:c4599164-4598631 [Klebsiella aerogenes]
MDQLLTIEMIADEFRYDITGFDCGEEALNTFLKEHLKRQHDGQILRGYALVSGDTVPRLLGYYTLSGSCFERGMLPSKTQ
QKKIPYQNAPSVTLGRLAIDKSVQGRGWGEMLVAHAMRVVWGASKAVGIYGLFVEALNEKAKAFYLRLGFIQLVDENSNL
LFYPTKSIEQLFTDDES
MDQLLTIEMIADEFRYDITGFDCGEEALNTFLKEHLKRQHDGQILRGYALVSGDTVPRLLGYYTLSGSCFERGMLPSKTQ
QKKIPYQNAPSVTLGRLAIDKSVQGRGWGEMLVAHAMRVVWGASKAVGIYGLFVEALNEKAKAFYLRLGFIQLVDENSNL
LFYPTKSIEQLFTDDES
Download Length: 534 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|