Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3944295..3944914 | Replicon | chromosome |
| Accession | NZ_CP099252 | ||
| Organism | Klebsiella aerogenes strain RHB11-E1-C08 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | A0A0H3FXE2 |
| Locus tag | NFJ68_RS19185 | Protein ID | WP_015367918.1 |
| Coordinates | 3944696..3944914 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | A0A0H3FPM3 |
| Locus tag | NFJ68_RS19180 | Protein ID | WP_015367917.1 |
| Coordinates | 3944295..3944669 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFJ68_RS19170 (NFJ68_19140) | 3939454..3940653 | + | 1200 | WP_020079451.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| NFJ68_RS19175 (NFJ68_19145) | 3940676..3943822 | + | 3147 | WP_015367916.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| NFJ68_RS19180 (NFJ68_19150) | 3944295..3944669 | + | 375 | WP_015367917.1 | Hha toxicity modulator TomB | Antitoxin |
| NFJ68_RS19185 (NFJ68_19155) | 3944696..3944914 | + | 219 | WP_015367918.1 | HHA domain-containing protein | Toxin |
| NFJ68_RS19190 (NFJ68_19160) | 3945046..3945609 | + | 564 | WP_020079452.1 | maltose O-acetyltransferase | - |
| NFJ68_RS19195 (NFJ68_19165) | 3945735..3946199 | + | 465 | WP_015367920.1 | YlaC family protein | - |
| NFJ68_RS19200 (NFJ68_19170) | 3946174..3947628 | - | 1455 | WP_020079453.1 | PLP-dependent aminotransferase family protein | - |
| NFJ68_RS19205 (NFJ68_19175) | 3947731..3948441 | + | 711 | WP_015704607.1 | GNAT family protein | - |
| NFJ68_RS19210 (NFJ68_19180) | 3948438..3948578 | - | 141 | WP_020079454.1 | type B 50S ribosomal protein L36 | - |
| NFJ68_RS19215 (NFJ68_19185) | 3948581..3948841 | - | 261 | WP_015367923.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8569.96 Da Isoelectric Point: 9.4828
>T248266 WP_015367918.1 NZ_CP099252:3944696-3944914 [Klebsiella aerogenes]
MSGKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSGKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14464.21 Da Isoelectric Point: 4.9045
>AT248266 WP_015367917.1 NZ_CP099252:3944295-3944669 [Klebsiella aerogenes]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNRGWVNDPTSAVNLQLNELIEHIATYALNYKIKYAEDNKLISQLDEYL
DDTFMLFSSYGINTSDLQKWRKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNRGWVNDPTSAVNLQLNELIEHIATYALNYKIKYAEDNKLISQLDEYL
DDTFMLFSSYGINTSDLQKWRKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3FXE2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3FPM3 |