Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 851229..851886 | Replicon | chromosome |
| Accession | NZ_CP099252 | ||
| Organism | Klebsiella aerogenes strain RHB11-E1-C08 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A0H3FM52 |
| Locus tag | NFJ68_RS04125 | Protein ID | WP_015369792.1 |
| Coordinates | 851476..851886 (+) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | A0A0H3FJK6 |
| Locus tag | NFJ68_RS04120 | Protein ID | WP_015369791.1 |
| Coordinates | 851229..851495 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFJ68_RS04095 (NFJ68_04095) | 846456..847889 | - | 1434 | WP_032712496.1 | 6-phospho-beta-glucosidase BglA | - |
| NFJ68_RS04100 (NFJ68_04100) | 848009..848737 | - | 729 | WP_020077980.1 | MurR/RpiR family transcriptional regulator | - |
| NFJ68_RS04105 (NFJ68_04105) | 848788..849099 | + | 312 | WP_116289392.1 | N(4)-acetylcytidine aminohydrolase | - |
| NFJ68_RS04110 (NFJ68_04110) | 849264..849923 | + | 660 | WP_008806429.1 | hemolysin III family protein | - |
| NFJ68_RS04115 (NFJ68_04115) | 850022..851005 | - | 984 | WP_015369790.1 | tRNA-modifying protein YgfZ | - |
| NFJ68_RS04120 (NFJ68_04120) | 851229..851495 | + | 267 | WP_015369791.1 | FAD assembly factor SdhE | Antitoxin |
| NFJ68_RS04125 (NFJ68_04125) | 851476..851886 | + | 411 | WP_015369792.1 | protein YgfX | Toxin |
| NFJ68_RS04130 (NFJ68_04130) | 851894..852415 | - | 522 | WP_045387211.1 | flavodoxin FldB | - |
| NFJ68_RS04135 (NFJ68_04135) | 852516..853412 | + | 897 | WP_045414365.1 | site-specific tyrosine recombinase XerD | - |
| NFJ68_RS04140 (NFJ68_04140) | 853435..854148 | + | 714 | WP_116289391.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| NFJ68_RS04145 (NFJ68_04145) | 854154..855887 | + | 1734 | WP_015369796.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 15887.69 Da Isoelectric Point: 10.0200
>T248260 WP_015369792.1 NZ_CP099252:851476-851886 [Klebsiella aerogenes]
VVLWQSDLRISWRSQWFSLLLHGVVAAIVLLMPWPLSYTPIWLLLLSLVVFDCVRSQRRIHACQGEIKLLIDSRLRWQKT
EWDIVGTPWVISSGMLLRLKHAETGRSQHLWVAADSMDAGEWRDLRRLVLQKPAHD
VVLWQSDLRISWRSQWFSLLLHGVVAAIVLLMPWPLSYTPIWLLLLSLVVFDCVRSQRRIHACQGEIKLLIDSRLRWQKT
EWDIVGTPWVISSGMLLRLKHAETGRSQHLWVAADSMDAGEWRDLRRLVLQKPAHD
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3FM52 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3FJK6 |