Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PP_4151-4152/excise(antitoxin) |
Location | 75146..76167 | Replicon | chromosome |
Accession | NZ_CP099252 | ||
Organism | Klebsiella aerogenes strain RHB11-E1-C08 |
Toxin (Protein)
Gene name | PP_4152 | Uniprot ID | A0A0G9UXE3 |
Locus tag | NFJ68_RS00375 | Protein ID | WP_032706547.1 |
Coordinates | 75592..76167 (+) | Length | 192 a.a. |
Antitoxin (Protein)
Gene name | PP_4151 | Uniprot ID | - |
Locus tag | NFJ68_RS00370 | Protein ID | WP_047043205.1 |
Coordinates | 75146..75592 (+) | Length | 149 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFJ68_RS00345 (NFJ68_00345) | 70667..71446 | + | 780 | WP_015703851.1 | MBL fold metallo-hydrolase | - |
NFJ68_RS00350 (NFJ68_00350) | 71468..72421 | + | 954 | WP_015703850.1 | helix-turn-helix domain-containing protein | - |
NFJ68_RS00355 (NFJ68_00355) | 72418..73467 | - | 1050 | WP_063445250.1 | NAD(P)-dependent alcohol dehydrogenase | - |
NFJ68_RS00360 (NFJ68_00360) | 73625..73927 | - | 303 | WP_042893661.1 | putative quinol monooxygenase | - |
NFJ68_RS00365 (NFJ68_00365) | 73928..74935 | - | 1008 | WP_042893659.1 | zinc-binding alcohol dehydrogenase family protein | - |
NFJ68_RS00370 (NFJ68_00370) | 75146..75592 | + | 447 | WP_047043205.1 | helix-turn-helix domain-containing protein | Antitoxin |
NFJ68_RS00375 (NFJ68_00375) | 75592..76167 | + | 576 | WP_032706547.1 | PIN domain-containing protein | Toxin |
NFJ68_RS00380 (NFJ68_00380) | 76472..77668 | + | 1197 | WP_042893658.1 | hypothetical protein | - |
NFJ68_RS00385 (NFJ68_00385) | 77951..78988 | - | 1038 | WP_045411414.1 | virulence RhuM family protein | - |
NFJ68_RS00390 (NFJ68_00390) | 79223..79511 | - | 289 | Protein_77 | SymE family type I addiction module toxin | - |
NFJ68_RS00395 (NFJ68_00395) | 79583..79885 | - | 303 | WP_020077664.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 192 a.a. Molecular weight: 21688.29 Da Isoelectric Point: 6.2900
>T248258 WP_032706547.1 NZ_CP099252:75592-76167 [Klebsiella aerogenes]
MRHSPYPVILDACVLYPARLRDLLMHLGIAGLYQPKWSRFIHDEWCRNLLINRPDIAPEALRRTVDLMNAALPDANVTGF
AGLINGLVLPDPDDRHVLAAAIRAKAEIIVTLNHKDFPAESLLPFEIETLHPDVFISDLFDLNHALALEAVRRQRQSLKH
PPMTVDEFLEMLLKQGLPMTVKELANYQYAI
MRHSPYPVILDACVLYPARLRDLLMHLGIAGLYQPKWSRFIHDEWCRNLLINRPDIAPEALRRTVDLMNAALPDANVTGF
AGLINGLVLPDPDDRHVLAAAIRAKAEIIVTLNHKDFPAESLLPFEIETLHPDVFISDLFDLNHALALEAVRRQRQSLKH
PPMTVDEFLEMLLKQGLPMTVKELANYQYAI
Download Length: 576 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16698.27 Da Isoelectric Point: 6.4921
>AT248258 WP_047043205.1 NZ_CP099252:75146-75592 [Klebsiella aerogenes]
MTKLNLPNPLESELAQRGQRELAAYLSTHLETQRIAIVGEDDKTHTIELPTSALTMLMEILGELACGNAVQIVPVHAELT
TQEAANILNVSRPHMVKLLEARKLPFHKTGRHRRVLFADLMEYKKRREQESLDAMQALADQAQDLGMY
MTKLNLPNPLESELAQRGQRELAAYLSTHLETQRIAIVGEDDKTHTIELPTSALTMLMEILGELACGNAVQIVPVHAELT
TQEAANILNVSRPHMVKLLEARKLPFHKTGRHRRVLFADLMEYKKRREQESLDAMQALADQAQDLGMY
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|