Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 817020..817674 | Replicon | chromosome |
Accession | NZ_CP099222 | ||
Organism | Citrobacter freundii strain RHB13-SO-C05 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | - |
Locus tag | NFJ76_RS03995 | Protein ID | WP_096755799.1 |
Coordinates | 817267..817674 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | - |
Locus tag | NFJ76_RS03990 | Protein ID | WP_279271574.1 |
Coordinates | 817020..817286 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFJ76_RS03965 (812228) | 812228..813667 | - | 1440 | WP_181637573.1 | 6-phospho-beta-glucosidase BglA | - |
NFJ76_RS03970 (813788) | 813788..814516 | - | 729 | WP_115259901.1 | MurR/RpiR family transcriptional regulator | - |
NFJ76_RS03975 (814569) | 814569..814880 | + | 312 | WP_279271573.1 | N(4)-acetylcytidine aminohydrolase | - |
NFJ76_RS03980 (815044) | 815044..815703 | + | 660 | WP_096755796.1 | hemolysin III family protein | - |
NFJ76_RS03985 (815783) | 815783..816763 | - | 981 | WP_115257540.1 | tRNA-modifying protein YgfZ | - |
NFJ76_RS03990 (817020) | 817020..817286 | + | 267 | WP_279271574.1 | FAD assembly factor SdhE | Antitoxin |
NFJ76_RS03995 (817267) | 817267..817674 | + | 408 | WP_096755799.1 | protein YgfX | Toxin |
NFJ76_RS04000 (817720) | 817720..818241 | - | 522 | WP_279271575.1 | flavodoxin FldB | - |
NFJ76_RS04005 (818354) | 818354..819250 | + | 897 | WP_096755801.1 | site-specific tyrosine recombinase XerD | - |
NFJ76_RS04010 (819274) | 819274..819987 | + | 714 | WP_096755802.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
NFJ76_RS04015 (819993) | 819993..821726 | + | 1734 | WP_181631884.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15935.93 Da Isoelectric Point: 11.2851
>T248248 WP_096755799.1 NZ_CP099222:817267-817674 [Citrobacter freundii]
VVQWQSDLRVSWRAQWISLLIHGLVAVLILLMPWPLSYTPLWLILLSLVVFDCVRSQRRINACQGEIRLLMDGRLRWQGQ
EWSIVSAPWMIKTGMMLRLRSSTGKRQHLWLAADSMDDAEWRDLRRLILQPSMQK
VVQWQSDLRVSWRAQWISLLIHGLVAVLILLMPWPLSYTPLWLILLSLVVFDCVRSQRRINACQGEIRLLMDGRLRWQGQ
EWSIVSAPWMIKTGMMLRLRSSTGKRQHLWLAADSMDDAEWRDLRRLILQPSMQK
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|