Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 173430..173980 Replicon plasmid unnamed1
Accession NZ_CP099218
Organism Citrobacter freundii strain RHB16-SO-C03

Toxin (Protein)


Gene name ccdB Uniprot ID S1EZ93
Locus tag NFJ87_RS26075 Protein ID WP_007372286.1
Coordinates 173672..173980 (+) Length 103 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID S1FMC3
Locus tag NFJ87_RS26070 Protein ID WP_007372285.1
Coordinates 173430..173669 (+) Length 80 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NFJ87_RS26025 (NFJ87_26010) 168437..168832 + 396 WP_024196081.1 hypothetical protein -
NFJ87_RS26030 (NFJ87_26015) 169014..169205 + 192 WP_016241560.1 hypothetical protein -
NFJ87_RS26035 (NFJ87_26020) 169336..170031 + 696 WP_007372278.1 hypothetical protein -
NFJ87_RS26040 (NFJ87_26025) 170054..170251 + 198 WP_032155220.1 Lar family restriction alleviation protein -
NFJ87_RS26045 (NFJ87_26030) 170304..170762 + 459 WP_008786599.1 hypothetical protein -
NFJ87_RS26050 (NFJ87_26035) 170910..171050 + 141 WP_007372281.1 hypothetical protein -
NFJ87_RS26055 (NFJ87_26040) 171066..171698 + 633 WP_007372282.1 hypothetical protein -
NFJ87_RS26060 (NFJ87_26045) 172156..172830 + 675 WP_008786597.1 hypothetical protein -
NFJ87_RS26065 (NFJ87_26050) 172827..173291 + 465 WP_008786596.1 hypothetical protein -
NFJ87_RS26070 (NFJ87_26055) 173430..173669 + 240 WP_007372285.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
NFJ87_RS26075 (NFJ87_26060) 173672..173980 + 309 WP_007372286.1 CcdB family protein Toxin
NFJ87_RS26080 (NFJ87_26065) 174001..174159 + 159 WP_016241558.1 hypothetical protein -
NFJ87_RS26085 (NFJ87_26070) 174314..174868 + 555 WP_007372288.1 hypothetical protein -
NFJ87_RS26090 (NFJ87_26075) 174938..175555 + 618 WP_007372289.1 hypothetical protein -
NFJ87_RS26095 (NFJ87_26080) 175578..176108 + 531 WP_016241557.1 HAD domain-containing protein -
NFJ87_RS26100 (NFJ87_26085) 176410..176697 + 288 WP_016241556.1 hypothetical protein -
NFJ87_RS26105 (NFJ87_26090) 176708..177106 + 399 WP_007372292.1 hypothetical protein -
NFJ87_RS26110 (NFJ87_26095) 177190..177516 + 327 WP_007372293.1 hypothetical protein -
NFJ87_RS26115 (NFJ87_26100) 177879..178217 - 339 WP_007372294.1 hypothetical protein -
NFJ87_RS26120 (NFJ87_26105) 178455..178898 + 444 WP_007372295.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..217792 217792


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-101)

Antitoxin

Post-segregation antitoxin CcdA

(9-79)


Sequences

Toxin        


Download         Length: 103 a.a.        Molecular weight: 11351.17 Da        Isoelectric Point: 8.5044

>T248245 WP_007372286.1 NZ_CP099218:173672-173980 [Citrobacter freundii]
MQYTVYRNPGNSQAYPYLLDIQSDIIGELNTRLVIPLHRLKKGASAPVARLTPVIQVEGNDVILMTHEMASVRVKQLGQA
VMDASPFRHTIKSAVDFLLDGF

Download         Length: 309 bp

Antitoxin


Download         Length: 80 a.a.        Molecular weight: 8784.97 Da        Isoelectric Point: 8.6387

>AT248245 WP_007372285.1 NZ_CP099218:173430-173669 [Citrobacter freundii]
MQATAARQKKTVSVTLEPMLVQQAKDAGINLSATLAEALQSKLKASAAEEWKRQNRAGIQELNRITEEHGLLSDEYRTF

Download         Length: 240 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1EZ93

Antitoxin

Source ID Structure
AlphaFold DB S1FMC3

References