Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/ParE-RHH
Location 30955..31474 Replicon plasmid unnamed1
Accession NZ_CP099218
Organism Citrobacter freundii strain RHB16-SO-C03

Toxin (Protein)


Gene name parE Uniprot ID A0A837F4A9
Locus tag NFJ87_RS25190 Protein ID WP_000277490.1
Coordinates 30955..31239 (-) Length 95 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID A0A6P1V8C3
Locus tag NFJ87_RS25195 Protein ID WP_000124732.1
Coordinates 31232..31474 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NFJ87_RS25165 (NFJ87_25150) 26177..26874 + 698 WP_249825458.1 IS1-like element IS1A family transposase -
NFJ87_RS25170 (NFJ87_25155) 27012..27302 - 291 WP_227641047.1 CPBP family intramembrane metalloprotease -
NFJ87_RS25175 (NFJ87_25160) 28386..29045 - 660 WP_001567320.1 recombinase family protein -
NFJ87_RS25180 (NFJ87_25165) 29381..30403 + 1023 WP_001567660.1 IS110 family transposase -
NFJ87_RS25185 (NFJ87_25170) 30725..30817 + 93 Protein_37 plasmid partition protein ParG -
NFJ87_RS25190 (NFJ87_25175) 30955..31239 - 285 WP_000277490.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NFJ87_RS25195 (NFJ87_25180) 31232..31474 - 243 WP_000124732.1 type II toxin-antitoxin system ParD family antitoxin Antitoxin
NFJ87_RS25200 (NFJ87_25185) 31692..32396 + 705 WP_279270928.1 IS6-like element IS26 family transposase -
NFJ87_RS25205 (NFJ87_25190) 32449..32559 + 111 Protein_41 GlxA family transcriptional regulator -
NFJ87_RS25210 (NFJ87_25195) 32679..32969 + 291 WP_016241603.1 antibiotic biosynthesis monooxygenase family protein -
NFJ87_RS25215 (NFJ87_25200) 32937..33110 - 174 WP_166488550.1 hypothetical protein -
NFJ87_RS25220 (NFJ87_25205) 33142..34122 + 981 WP_279270926.1 IS5-like element ISKpn26 family transposase -
NFJ87_RS25225 (NFJ87_25210) 34260..34463 + 204 Protein_45 IS3 family transposase -
NFJ87_RS25230 (NFJ87_25215) 34480..35643 + 1164 WP_023336801.1 1,3-propanediol dehydrogenase -
NFJ87_RS25235 (NFJ87_25220) 35664..36017 + 354 WP_086801900.1 glycerol dehydratase reactivase beta/small subunit family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..217792 217792
- inside IScluster/Tn - - 26371..40734 14363


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(2-88)

Antitoxin

Antitoxin ParD

(1-64)


Sequences

Toxin        


Download         Length: 95 a.a.        Molecular weight: 11005.52 Da        Isoelectric Point: 6.2103

>T248244 WP_000277490.1 NZ_CP099218:c31239-30955 [Citrobacter freundii]
VYKLTERAADDFAGIYDYTLLKFGEAQADHYTDALEAFFETLAGMPDMGRDYHTVPGVMRIEFQRHAIFYTVRDTDILIA
RILHQQMNHKRHLL

Download         Length: 285 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 8875.01 Da        Isoelectric Point: 7.0130

>AT248244 WP_000124732.1 NZ_CP099218:c31474-31232 [Citrobacter freundii]
MARTTSVTIGEQLDSFISRLIDSGRYGSASEVMRSALRLLEQQETNDEVIRQAVIAGLESGESSLSLRDIAAQRKLRHRV

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A837F4A9

Antitoxin

Source ID Structure
AlphaFold DB A0A6P1V8C3

References