Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 4980092..4980708 | Replicon | chromosome |
| Accession | NZ_CP099217 | ||
| Organism | Citrobacter freundii strain RHB16-SO-C03 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | NFJ87_RS24160 | Protein ID | WP_279270486.1 |
| Coordinates | 4980092..4980466 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A6B5NTK4 |
| Locus tag | NFJ87_RS24165 | Protein ID | WP_043018956.1 |
| Coordinates | 4980466..4980708 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFJ87_RS24145 (4977595) | 4977595..4978497 | + | 903 | WP_003028691.1 | formate dehydrogenase O subunit beta | - |
| NFJ87_RS24150 (4978494) | 4978494..4979129 | + | 636 | WP_003028686.1 | formate dehydrogenase cytochrome b556 subunit | - |
| NFJ87_RS24155 (4979126) | 4979126..4980055 | + | 930 | WP_003028685.1 | formate dehydrogenase accessory protein FdhE | - |
| NFJ87_RS24160 (4980092) | 4980092..4980466 | - | 375 | WP_279270486.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NFJ87_RS24165 (4980466) | 4980466..4980708 | - | 243 | WP_043018956.1 | CopG family transcriptional regulator | Antitoxin |
| NFJ87_RS24170 (4980914) | 4980914..4981822 | + | 909 | WP_279270487.1 | alpha/beta hydrolase | - |
| NFJ87_RS24175 (4981973) | 4981973..4982914 | - | 942 | WP_003825286.1 | fatty acid biosynthesis protein FabY | - |
| NFJ87_RS24180 (4982959) | 4982959..4983396 | - | 438 | WP_003028671.1 | D-aminoacyl-tRNA deacylase | - |
| NFJ87_RS24185 (4983393) | 4983393..4984265 | - | 873 | WP_060854619.1 | virulence factor BrkB family protein | - |
| NFJ87_RS24190 (4984259) | 4984259..4984858 | - | 600 | WP_279270488.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13655.84 Da Isoelectric Point: 8.5343
>T248243 WP_279270486.1 NZ_CP099217:c4980466-4980092 [Citrobacter freundii]
MVKGSALFDTNILIDLFSGRNEAKLAIETWPPQNAISLITWMEVMVGAKKYHQEARTRVALGAFNVIGVSQDIAERSVSI
RQEYGMKLPDAIILATAQIHHLTLVTRNTKDFAGLSGVVTPYTL
MVKGSALFDTNILIDLFSGRNEAKLAIETWPPQNAISLITWMEVMVGAKKYHQEARTRVALGAFNVIGVSQDIAERSVSI
RQEYGMKLPDAIILATAQIHHLTLVTRNTKDFAGLSGVVTPYTL
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|