Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4666710..4667513 | Replicon | chromosome |
| Accession | NZ_CP099217 | ||
| Organism | Citrobacter freundii strain RHB16-SO-C03 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A6N6JYU3 |
| Locus tag | NFJ87_RS22780 | Protein ID | WP_024156451.1 |
| Coordinates | 4667133..4667513 (+) | Length | 127 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A5A9BSL8 |
| Locus tag | NFJ87_RS22775 | Protein ID | WP_038807908.1 |
| Coordinates | 4666710..4667075 (+) | Length | 122 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFJ87_RS22735 (4662381) | 4662381..4662584 | + | 204 | WP_279270446.1 | hypothetical protein | - |
| NFJ87_RS22740 (4662878) | 4662878..4663345 | + | 468 | WP_043017583.1 | hypothetical protein | - |
| NFJ87_RS22745 (4663409) | 4663409..4663942 | + | 534 | WP_024156443.1 | DUF4234 domain-containing protein | - |
| NFJ87_RS22750 (4664032) | 4664032..4664283 | + | 252 | WP_024156444.1 | DUF905 family protein | - |
| NFJ87_RS22755 (4664401) | 4664401..4665219 | + | 819 | WP_024156445.1 | DUF932 domain-containing protein | - |
| NFJ87_RS22760 (4665488) | 4665488..4665961 | + | 474 | WP_218711147.1 | antirestriction protein | - |
| NFJ87_RS22765 (4665974) | 4665974..4666453 | + | 480 | WP_024156448.1 | DNA repair protein RadC | - |
| NFJ87_RS22770 (4666467) | 4666467..4666688 | + | 222 | WP_218710008.1 | DUF987 domain-containing protein | - |
| NFJ87_RS22775 (4666710) | 4666710..4667075 | + | 366 | WP_038807908.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| NFJ87_RS22780 (4667133) | 4667133..4667513 | + | 381 | WP_024156451.1 | TA system toxin CbtA family protein | Toxin |
| NFJ87_RS22785 (4667510) | 4667510..4668001 | + | 492 | WP_024156452.1 | DUF5983 family protein | - |
| NFJ87_RS22790 (4668031) | 4668031..4668227 | + | 197 | Protein_4469 | hypothetical protein | - |
| NFJ87_RS22795 (4668310) | 4668310..4669158 | + | 849 | WP_279270447.1 | DUF4942 domain-containing protein | - |
| NFJ87_RS22800 (4669949) | 4669949..4671610 | + | 1662 | WP_103848366.1 | fatty acid--CoA ligase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 14263.44 Da Isoelectric Point: 10.0919
>T248242 WP_024156451.1 NZ_CP099217:4667133-4667513 [Citrobacter freundii]
MQTLSAIPKRKAPSRPTPVEIWQQLLTYLLKRHYGLSLSDTQFSDEEIITQYIDAGISLSDALNFLVEKSELVRIDRPGF
SIKHQSPFIGVIDILRARRATGLMQRNGYKRITLLIAGNAAQEQHS
MQTLSAIPKRKAPSRPTPVEIWQQLLTYLLKRHYGLSLSDTQFSDEEIITQYIDAGISLSDALNFLVEKSELVRIDRPGF
SIKHQSPFIGVIDILRARRATGLMQRNGYKRITLLIAGNAAQEQHS
Download Length: 381 bp
Antitoxin
Download Length: 122 a.a. Molecular weight: 13344.20 Da Isoelectric Point: 5.8705
>AT248242 WP_038807908.1 NZ_CP099217:4666710-4667075 [Citrobacter freundii]
MSNPIPPVNHDVSEPWWGLKPGITPCFGARLVQEGNRLHYLADRASIAGVFSDADLRHLDQAFPVLLKQLELMLVSGELN
PCHQHCVTLYAKGLTCEADSLGSHGYIYTAIYPTPDDSITR
MSNPIPPVNHDVSEPWWGLKPGITPCFGARLVQEGNRLHYLADRASIAGVFSDADLRHLDQAFPVLLKQLELMLVSGELN
PCHQHCVTLYAKGLTCEADSLGSHGYIYTAIYPTPDDSITR
Download Length: 366 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6N6JYU3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5A9BSL8 |