Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4586953..4587469 | Replicon | chromosome |
| Accession | NZ_CP099217 | ||
| Organism | Citrobacter freundii strain RHB16-SO-C03 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A0J1MTE6 |
| Locus tag | NFJ87_RS22400 | Protein ID | WP_016149473.1 |
| Coordinates | 4587185..4587469 (+) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A0J1MV10 |
| Locus tag | NFJ87_RS22395 | Protein ID | WP_003839576.1 |
| Coordinates | 4586953..4587195 (+) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFJ87_RS22375 (4581968) | 4581968..4583101 | + | 1134 | WP_048241739.1 | amidohydrolase/deacetylase family metallohydrolase | - |
| NFJ87_RS22380 (4583085) | 4583085..4584203 | + | 1119 | WP_048216923.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
| NFJ87_RS22385 (4584200) | 4584200..4584940 | + | 741 | WP_048216922.1 | KDGP aldolase family protein | - |
| NFJ87_RS22390 (4584962) | 4584962..4586875 | + | 1914 | WP_048241736.1 | BglG family transcription antiterminator | - |
| NFJ87_RS22395 (4586953) | 4586953..4587195 | + | 243 | WP_003839576.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| NFJ87_RS22400 (4587185) | 4587185..4587469 | + | 285 | WP_016149473.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NFJ87_RS22405 (4587473) | 4587473..4587937 | - | 465 | WP_279270436.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| NFJ87_RS22410 (4588122) | 4588122..4590260 | - | 2139 | WP_003025782.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| NFJ87_RS22415 (4590669) | 4590669..4592321 | - | 1653 | WP_279270437.1 | alpha,alpha-phosphotrehalase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10878.73 Da Isoelectric Point: 10.0482
>T248241 WP_016149473.1 NZ_CP099217:4587185-4587469 [Citrobacter freundii]
MTYELEFDPRALKEWHKLGDTVKAQFKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDEVVIVFVVAVGK
REHSAVYLDANKRL
MTYELEFDPRALKEWHKLGDTVKAQFKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDEVVIVFVVAVGK
REHSAVYLDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J1MTE6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J1MV10 |