Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) ykfI-yfjZ/CbtA-CbeA
Location 4391055..4391746 Replicon chromosome
Accession NZ_CP099217
Organism Citrobacter freundii strain RHB16-SO-C03

Toxin (Protein)


Gene name ykfI Uniprot ID -
Locus tag NFJ87_RS21430 Protein ID WP_167736373.1
Coordinates 4391055..4391393 (-) Length 113 a.a.

Antitoxin (Protein)


Gene name yfjZ Uniprot ID -
Locus tag NFJ87_RS21435 Protein ID WP_167736374.1
Coordinates 4391429..4391746 (-) Length 106 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NFJ87_RS21405 (4386973) 4386973..4387254 + 282 Protein_4197 SymE family type I addiction module toxin -
NFJ87_RS21410 (4387269) 4387269..4387904 - 636 WP_279270397.1 HNH endonuclease -
NFJ87_RS21415 (4388045) 4388045..4388917 + 873 WP_279270398.1 HNH endonuclease -
NFJ87_RS21420 (4389077) 4389077..4389874 - 798 WP_279270399.1 helix-turn-helix transcriptional regulator -
NFJ87_RS21425 (4390107) 4390107..4390940 - 834 WP_279270400.1 DUF4942 domain-containing protein -
NFJ87_RS21430 (4391055) 4391055..4391393 - 339 WP_167736373.1 TA system toxin CbtA family protein Toxin
NFJ87_RS21435 (4391429) 4391429..4391746 - 318 WP_167736374.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
NFJ87_RS21440 (4391765) 4391765..4391986 - 222 WP_110249213.1 DUF987 domain-containing protein -
NFJ87_RS21445 (4391995) 4391995..4392471 - 477 WP_167736375.1 RadC family protein -
NFJ87_RS21450 (4392487) 4392487..4392945 - 459 WP_279270401.1 antirestriction protein -
NFJ87_RS21455 (4393042) 4393042..4393281 - 240 WP_279270402.1 DUF905 domain-containing protein -
NFJ87_RS21460 (4393359) 4393359..4393832 - 474 WP_279270403.1 hypothetical protein -
NFJ87_RS21465 (4393854) 4393854..4394549 - 696 WP_279270404.1 hypothetical protein -
NFJ87_RS21470 (4394732) 4394732..4395433 - 702 WP_149330776.1 WYL domain-containing protein -
NFJ87_RS21475 (4395650) 4395650..4396471 - 822 WP_032751326.1 DUF932 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 4391055..4425799 34744


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-107)

Antitoxin

Antitoxin CbeA

(5-104)


Sequences

Toxin        


Download         Length: 113 a.a.        Molecular weight: 12793.85 Da        Isoelectric Point: 10.5111

>T248240 WP_167736373.1 NZ_CP099217:c4391393-4391055 [Citrobacter freundii]
MKSLPANQRVAKPCPPPVLVWQTLLTRLLKQHYGLALNDTPFSDENVIQEHINAGITLADAVNFLVEKYKLVRIDRRGFN
CQKQSPYLRAVDILRARQATGLLRQSYHPSTR

Download         Length: 339 bp

Antitoxin


Download         Length: 106 a.a.        Molecular weight: 12096.70 Da        Isoelectric Point: 6.0670

>AT248240 WP_167736374.1 NZ_CP099217:c4391746-4391429 [Citrobacter freundii]
MGNIKWGLQRDITPRLGARLVQEGNRLHYLADRASITGKFSDAECRKLDETFPHFISQMESMLTTDELNPRHAHCITLYQ
DELTCEADTLGSYGYVYIVIYPTQR

Download         Length: 318 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References