Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3790866..3791486 | Replicon | chromosome |
| Accession | NZ_CP099217 | ||
| Organism | Citrobacter freundii strain RHB16-SO-C03 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | R8WYV2 |
| Locus tag | NFJ87_RS18705 | Protein ID | WP_002892050.1 |
| Coordinates | 3791268..3791486 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | R8WZW8 |
| Locus tag | NFJ87_RS18700 | Protein ID | WP_003021733.1 |
| Coordinates | 3790866..3791240 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFJ87_RS18690 (3786012) | 3786012..3787205 | + | 1194 | WP_003835922.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| NFJ87_RS18695 (3787228) | 3787228..3790377 | + | 3150 | WP_003021736.1 | efflux RND transporter permease AcrB | - |
| NFJ87_RS18700 (3790866) | 3790866..3791240 | + | 375 | WP_003021733.1 | Hha toxicity modulator TomB | Antitoxin |
| NFJ87_RS18705 (3791268) | 3791268..3791486 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
| NFJ87_RS18710 (3791793) | 3791793..3792344 | + | 552 | WP_003835924.1 | maltose O-acetyltransferase | - |
| NFJ87_RS18715 (3792461) | 3792461..3792931 | + | 471 | WP_003021724.1 | YlaC family protein | - |
| NFJ87_RS18720 (3793010) | 3793010..3793150 | - | 141 | WP_005125190.1 | type B 50S ribosomal protein L36 | - |
| NFJ87_RS18725 (3793152) | 3793152..3793412 | - | 261 | WP_003835926.1 | type B 50S ribosomal protein L31 | - |
| NFJ87_RS18730 (3793601) | 3793601..3795154 | + | 1554 | WP_003835927.1 | EAL domain-containing protein | - |
| NFJ87_RS18735 (3795206) | 3795206..3795559 | - | 354 | WP_003831033.1 | DUF1428 family protein | - |
| NFJ87_RS18740 (3795624) | 3795624..3796253 | - | 630 | WP_003835929.1 | membrane protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T248239 WP_002892050.1 NZ_CP099217:3791268-3791486 [Citrobacter freundii]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14427.23 Da Isoelectric Point: 5.5653
>AT248239 WP_003021733.1 NZ_CP099217:3790866-3791240 [Citrobacter freundii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2P8K6F2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | R8WZW8 |