Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2494228..2494867 | Replicon | chromosome |
| Accession | NZ_CP099217 | ||
| Organism | Citrobacter freundii strain RHB16-SO-C03 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A8B5QF36 |
| Locus tag | NFJ87_RS12240 | Protein ID | WP_003020221.1 |
| Coordinates | 2494228..2494404 (+) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | NFJ87_RS12245 | Protein ID | WP_123924900.1 |
| Coordinates | 2494451..2494867 (+) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFJ87_RS12220 (2491007) | 2491007..2491237 | - | 231 | WP_048217543.1 | DUF2554 family protein | - |
| NFJ87_RS12225 (2491426) | 2491426..2491551 | - | 126 | WP_003020230.1 | DUF2474 domain-containing protein | - |
| NFJ87_RS12230 (2491551) | 2491551..2492561 | - | 1011 | WP_003020227.1 | cytochrome d ubiquinol oxidase subunit II | - |
| NFJ87_RS12235 (2492561) | 2492561..2493964 | - | 1404 | WP_003843730.1 | cytochrome ubiquinol oxidase subunit I | - |
| NFJ87_RS12240 (2494228) | 2494228..2494404 | + | 177 | WP_003020221.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| NFJ87_RS12245 (2494451) | 2494451..2494867 | + | 417 | WP_123924900.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| NFJ87_RS12250 (2494960) | 2494960..2496369 | + | 1410 | WP_279270871.1 | PLP-dependent aminotransferase family protein | - |
| NFJ87_RS12255 (2496698) | 2496698..2497843 | + | 1146 | WP_003020212.1 | ABC transporter substrate-binding protein | - |
| NFJ87_RS12260 (2497860) | 2497860..2498876 | + | 1017 | WP_003020210.1 | ABC transporter ATP-binding protein | - |
| NFJ87_RS12265 (2498877) | 2498877..2499821 | + | 945 | WP_279270872.1 | ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6769.80 Da Isoelectric Point: 11.2510
>T248238 WP_003020221.1 NZ_CP099217:2494228-2494404 [Citrobacter freundii]
VKQSEFRRWLESQGVAVTNGSNHLKLRYQGRRSVMPRHPGDEIKEALRKAIIKQLDLQ
VKQSEFRRWLESQGVAVTNGSNHLKLRYQGRRSVMPRHPGDEIKEALRKAIIKQLDLQ
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15126.36 Da Isoelectric Point: 4.5716
>AT248238 WP_123924900.1 NZ_CP099217:2494451-2494867 [Citrobacter freundii]
MRYPVTLTPAVEGGFVVSFPDIPEALTQGNTRHDALQAAQAALITAFEFYFDDNEAIPLPSAVSAEDDYVEIPLSVASKV
LLLNAFLESKITQQELANRIGRPKQEITRLFDLKHTTKIDAVQIAARALGKELALTML
MRYPVTLTPAVEGGFVVSFPDIPEALTQGNTRHDALQAAQAALITAFEFYFDDNEAIPLPSAVSAEDDYVEIPLSVASKV
LLLNAFLESKITQQELANRIGRPKQEITRLFDLKHTTKIDAVQIAARALGKELALTML
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|