Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 897109..897763 | Replicon | chromosome |
Accession | NZ_CP099217 | ||
Organism | Citrobacter freundii strain RHB16-SO-C03 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | A0A0J1NHY7 |
Locus tag | NFJ87_RS04495 | Protein ID | WP_003026936.1 |
Coordinates | 897356..897763 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | A0A6H3AT26 |
Locus tag | NFJ87_RS04490 | Protein ID | WP_003026938.1 |
Coordinates | 897109..897375 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFJ87_RS04465 (892310) | 892310..893743 | - | 1434 | WP_048218552.1 | 6-phospho-beta-glucosidase BglA | - |
NFJ87_RS04470 (893864) | 893864..894592 | - | 729 | WP_060855085.1 | MurR/RpiR family transcriptional regulator | - |
NFJ87_RS04475 (894645) | 894645..894956 | + | 312 | WP_044700802.1 | N(4)-acetylcytidine aminohydrolase | - |
NFJ87_RS04480 (895119) | 895119..895778 | + | 660 | WP_003026947.1 | hemolysin III family protein | - |
NFJ87_RS04485 (895872) | 895872..896852 | - | 981 | WP_003838269.1 | tRNA-modifying protein YgfZ | - |
NFJ87_RS04490 (897109) | 897109..897375 | + | 267 | WP_003026938.1 | FAD assembly factor SdhE | Antitoxin |
NFJ87_RS04495 (897356) | 897356..897763 | + | 408 | WP_003026936.1 | protein YgfX | Toxin |
NFJ87_RS04500 (897808) | 897808..898329 | - | 522 | WP_003026933.1 | flavodoxin FldB | - |
NFJ87_RS04505 (898443) | 898443..899339 | + | 897 | WP_003026928.1 | site-specific tyrosine recombinase XerD | - |
NFJ87_RS04510 (899363) | 899363..900076 | + | 714 | WP_279270585.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
NFJ87_RS04515 (900082) | 900082..901815 | + | 1734 | WP_016150943.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15953.89 Da Isoelectric Point: 11.4054
>T248232 WP_003026936.1 NZ_CP099217:897356-897763 [Citrobacter freundii]
VVQWQSDLRVSWRAQWLSLLIHGLVAVFILLMPWPLSYTPLWLVLLSLVVFDSVRSQRRINACQGEIRLLMDGRLRWQGQ
EWSIVSAPWMVKTGMMLRLRSDAGKRQHLWLAADSMDDAEWRDLRRLMLQKAKQK
VVQWQSDLRVSWRAQWLSLLIHGLVAVFILLMPWPLSYTPLWLVLLSLVVFDSVRSQRRINACQGEIRLLMDGRLRWQGQ
EWSIVSAPWMVKTGMMLRLRSDAGKRQHLWLAADSMDDAEWRDLRRLMLQKAKQK
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J1NHY7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6H3AT26 |