Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 786935..787720 | Replicon | chromosome |
| Accession | NZ_CP099217 | ||
| Organism | Citrobacter freundii strain RHB16-SO-C03 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | NFJ87_RS03905 | Protein ID | WP_040063377.1 |
| Coordinates | 786935..787312 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | NFJ87_RS03910 | Protein ID | WP_038633768.1 |
| Coordinates | 787361..787720 (-) | Length | 120 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFJ87_RS03885 (782974) | 782974..784833 | + | 1860 | WP_016150974.1 | bifunctional glutathionylspermidine amidase/synthase | - |
| NFJ87_RS03890 (785294) | 785294..786142 | - | 849 | WP_040229927.1 | DUF4942 domain-containing protein | - |
| NFJ87_RS03895 (786223) | 786223..786417 | - | 195 | WP_047661001.1 | DUF957 domain-containing protein | - |
| NFJ87_RS03900 (786447) | 786447..786938 | - | 492 | WP_040063379.1 | DUF5983 family protein | - |
| NFJ87_RS03905 (786935) | 786935..787312 | - | 378 | WP_040063377.1 | TA system toxin CbtA family protein | Toxin |
| NFJ87_RS03910 (787361) | 787361..787720 | - | 360 | WP_038633768.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| NFJ87_RS03915 (787743) | 787743..787964 | - | 222 | WP_038633763.1 | DUF987 domain-containing protein | - |
| NFJ87_RS03920 (787976) | 787976..788461 | - | 486 | WP_038642868.1 | DNA repair protein RadC | - |
| NFJ87_RS03925 (788514) | 788514..788909 | - | 396 | WP_052322945.1 | antirestriction protein | - |
| NFJ87_RS03930 (788987) | 788987..789250 | - | 264 | WP_038633754.1 | hypothetical protein | - |
| NFJ87_RS03935 (789250) | 789250..790068 | - | 819 | WP_001234374.1 | DUF932 domain-containing protein | - |
| NFJ87_RS03940 (790184) | 790184..790434 | - | 251 | Protein_773 | DUF905 family protein | - |
| NFJ87_RS03945 (790625) | 790625..791092 | - | 468 | WP_000727137.1 | hypothetical protein | - |
| NFJ87_RS03950 (791189) | 791189..791590 | - | 402 | WP_047660999.1 | hypothetical protein | - |
| NFJ87_RS03955 (791796) | 791796..792683 | - | 888 | WP_047661008.1 | 50S ribosome-binding GTPase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14020.87 Da Isoelectric Point: 6.8604
>T248231 WP_040063377.1 NZ_CP099217:c787312-786935 [Citrobacter freundii]
MQTQPVSPAREASPRLSPVEIWQRLLSHLLDHHYGLALNDTPFGNDDVIQEHIDAGISLCDAVNFIVEKYDLVRTDRYGS
STTEQSPLISSIDILRARKACGLMTRNGYRAVTDITTGKYSKMTR
MQTQPVSPAREASPRLSPVEIWQRLLSHLLDHHYGLALNDTPFGNDDVIQEHIDAGISLCDAVNFIVEKYDLVRTDRYGS
STTEQSPLISSIDILRARKACGLMTRNGYRAVTDITTGKYSKMTR
Download Length: 378 bp
Antitoxin
Download Length: 120 a.a. Molecular weight: 13318.30 Da Isoelectric Point: 7.4424
>AT248231 WP_038633768.1 NZ_CP099217:c787720-787361 [Citrobacter freundii]
MLNKTLPANHHISEPWWGLKRNITPCFGARLVQEGNRLHYLADRASITGTFTDADLRHLDQAFPVLLKQMELMLVSGELS
PRHQHCVTLYAKGLTCEADSLGSHGYIYIAIYPTPSVTS
MLNKTLPANHHISEPWWGLKRNITPCFGARLVQEGNRLHYLADRASITGTFTDADLRHLDQAFPVLLKQMELMLVSGELS
PRHQHCVTLYAKGLTCEADSLGSHGYIYIAIYPTPSVTS
Download Length: 360 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|