Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 301970..302556 Replicon chromosome
Accession NZ_CP099217
Organism Citrobacter freundii strain RHB16-SO-C03

Toxin (Protein)


Gene name doc Uniprot ID A0A0J1QS94
Locus tag NFJ87_RS01475 Protein ID WP_032937237.1
Coordinates 302188..302556 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID A0A0J1N092
Locus tag NFJ87_RS01470 Protein ID WP_032937236.1
Coordinates 301970..302191 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NFJ87_RS01445 (297769) 297769..298695 + 927 WP_003023435.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
NFJ87_RS01450 (298692) 298692..299969 + 1278 WP_003023436.1 branched chain amino acid ABC transporter permease LivM -
NFJ87_RS01455 (299966) 299966..300733 + 768 WP_003023438.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
NFJ87_RS01460 (300751) 300751..301464 + 714 WP_003827581.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
NFJ87_RS01465 (301567) 301567..301848 + 282 WP_003023442.1 hypothetical protein -
NFJ87_RS01470 (301970) 301970..302191 + 222 WP_032937236.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NFJ87_RS01475 (302188) 302188..302556 + 369 WP_032937237.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
NFJ87_RS01480 (302800) 302800..304116 + 1317 WP_003837839.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
NFJ87_RS01485 (304217) 304217..305104 + 888 WP_003837841.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
NFJ87_RS01490 (305101) 305101..305946 + 846 WP_003837843.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
NFJ87_RS01495 (305949) 305949..307019 + 1071 WP_003837845.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 298692..307759 9067


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(1-121)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13617.91 Da        Isoelectric Point: 6.9891

>T248229 WP_032937237.1 NZ_CP099217:302188-302556 [Citrobacter freundii]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIVLSANPDFVAMTVEAAAGQLTLEQIAHRLRH

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8306.41 Da        Isoelectric Point: 4.7906

>AT248229 WP_032937236.1 NZ_CP099217:301970-302191 [Citrobacter freundii]
MRTMNYSEARQNLAEVLESAVTGVPVTITRRGHKPAVIISAEEFERYQAARLDDEFADIMMIHGNEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0J1QS94

Antitoxin

Source ID Structure
AlphaFold DB A0A0J1N092

References