Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4668224..4668740 | Replicon | chromosome |
| Accession | NZ_CP099140 | ||
| Organism | Klebsiella pneumoniae strain RHB28-SO-C05 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | NFK38_RS22790 | Protein ID | WP_040216106.1 |
| Coordinates | 4668224..4668508 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | R4Y888 |
| Locus tag | NFK38_RS22795 | Protein ID | WP_002886901.1 |
| Coordinates | 4668498..4668740 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFK38_RS22765 (NFK38_22750) | 4663641..4663904 | - | 264 | WP_014908078.1 | PTS sugar transporter subunit IIB | - |
| NFK38_RS22770 (NFK38_22755) | 4664034..4664207 | + | 174 | WP_004146781.1 | hypothetical protein | - |
| NFK38_RS22775 (NFK38_22760) | 4664210..4664953 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
| NFK38_RS22780 (NFK38_22765) | 4665310..4667448 | + | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| NFK38_RS22785 (NFK38_22770) | 4667756..4668220 | + | 465 | WP_032418146.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| NFK38_RS22790 (NFK38_22775) | 4668224..4668508 | - | 285 | WP_040216106.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NFK38_RS22795 (NFK38_22780) | 4668498..4668740 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| NFK38_RS22800 (NFK38_22785) | 4668818..4670728 | - | 1911 | WP_040216105.1 | PRD domain-containing protein | - |
| NFK38_RS22805 (NFK38_22790) | 4670751..4671905 | - | 1155 | WP_002886900.1 | lactonase family protein | - |
| NFK38_RS22810 (NFK38_22795) | 4671972..4672712 | - | 741 | WP_004186692.1 | KDGP aldolase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11097.94 Da Isoelectric Point: 10.4962
>T248226 WP_040216106.1 NZ_CP099140:c4668508-4668224 [Klebsiella pneumoniae]
MTYELAFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELAFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|