Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | kacAT/DUF1778(antitoxin) |
| Location | 4559248..4560058 | Replicon | chromosome |
| Accession | NZ_CP099140 | ||
| Organism | Klebsiella pneumoniae strain RHB28-SO-C05 | ||
Toxin (Protein)
| Gene name | KacT | Uniprot ID | - |
| Locus tag | NFK38_RS22330 | Protein ID | WP_048337996.1 |
| Coordinates | 4559248..4559781 (-) | Length | 178 a.a. |
Antitoxin (Protein)
| Gene name | KacA | Uniprot ID | J2E9Q7 |
| Locus tag | NFK38_RS22335 | Protein ID | WP_002887278.1 |
| Coordinates | 4559792..4560058 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFK38_RS22325 (NFK38_22310) | 4558079..4559200 | + | 1122 | WP_004214138.1 | cupin domain-containing protein | - |
| NFK38_RS22330 (NFK38_22315) | 4559248..4559781 | - | 534 | WP_048337996.1 | type II toxin-antitoxin system toxin KacT | Toxin |
| NFK38_RS22335 (NFK38_22320) | 4559792..4560058 | - | 267 | WP_002887278.1 | type II toxin-antitoxin system antitoxin KacA | Antitoxin |
| NFK38_RS22340 (NFK38_22325) | 4560161..4561594 | - | 1434 | WP_044245276.1 | Cu(+)/Ag(+) sensor histidine kinase | - |
| NFK38_RS22345 (NFK38_22330) | 4561584..4562267 | - | 684 | WP_032105399.1 | copper response regulator transcription factor CusR | - |
| NFK38_RS22350 (NFK38_22335) | 4562439..4563824 | + | 1386 | WP_048337995.1 | efflux transporter outer membrane subunit | - |
| NFK38_RS22355 (NFK38_22340) | 4563842..4564186 | + | 345 | WP_021462623.1 | cation efflux system protein CusF | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 178 a.a. Molecular weight: 19824.68 Da Isoelectric Point: 5.2614
>T248225 WP_048337996.1 NZ_CP099140:c4559781-4559248 [Klebsiella pneumoniae]
MEQQLTIEMIADAFSYDITGFDCGEEALNTFLKEHLKRQHDGQILRGYALVSGDTVPRLLGYYTLSGSCFERGMLPSKTQ
QKKIPYQNAPSVTLGRLAIDKSLQGQGWGEMLVAHAMRVVWGASKAVGIYGLFVEALNEKAKAFYLRLGFIQLVDENSNL
LFYPTKSIEQLFTDDES
MEQQLTIEMIADAFSYDITGFDCGEEALNTFLKEHLKRQHDGQILRGYALVSGDTVPRLLGYYTLSGSCFERGMLPSKTQ
QKKIPYQNAPSVTLGRLAIDKSLQGQGWGEMLVAHAMRVVWGASKAVGIYGLFVEALNEKAKAFYLRLGFIQLVDENSNL
LFYPTKSIEQLFTDDES
Download Length: 534 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|