Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3964699..3965318 | Replicon | chromosome |
| Accession | NZ_CP099140 | ||
| Organism | Klebsiella pneumoniae strain RHB28-SO-C05 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | R8WYV2 |
| Locus tag | NFK38_RS19470 | Protein ID | WP_002892050.1 |
| Coordinates | 3965100..3965318 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | J2DPF6 |
| Locus tag | NFK38_RS19465 | Protein ID | WP_002892066.1 |
| Coordinates | 3964699..3965073 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFK38_RS19455 (NFK38_19440) | 3959851..3961044 | + | 1194 | WP_004177236.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| NFK38_RS19460 (NFK38_19445) | 3961067..3964213 | + | 3147 | WP_002892069.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| NFK38_RS19465 (NFK38_19450) | 3964699..3965073 | + | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
| NFK38_RS19470 (NFK38_19455) | 3965100..3965318 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
| NFK38_RS19475 (NFK38_19460) | 3965477..3966043 | + | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
| NFK38_RS19480 (NFK38_19465) | 3966015..3966155 | - | 141 | WP_004147370.1 | hypothetical protein | - |
| NFK38_RS19485 (NFK38_19470) | 3966176..3966646 | + | 471 | WP_048337480.1 | YlaC family protein | - |
| NFK38_RS19490 (NFK38_19475) | 3966621..3968072 | - | 1452 | WP_048337479.1 | PLP-dependent aminotransferase family protein | - |
| NFK38_RS19495 (NFK38_19480) | 3968173..3968871 | + | 699 | WP_002892021.1 | GNAT family protein | - |
| NFK38_RS19500 (NFK38_19485) | 3968868..3969008 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
| NFK38_RS19505 (NFK38_19490) | 3969008..3969271 | - | 264 | WP_002892011.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T248224 WP_002892050.1 NZ_CP099140:3965100-3965318 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT248224 WP_002892066.1 NZ_CP099140:3964699-3965073 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2P8K6F2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GJ93 |