Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4414691..4415479 | Replicon | chromosome |
| Accession | NZ_CP099128 | ||
| Organism | Citrobacter freundii strain RHB31-E4-C06 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A7L6ILI8 |
| Locus tag | NFK47_RS21225 | Protein ID | WP_047359063.1 |
| Coordinates | 4415102..4415479 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | NFK47_RS21220 | Protein ID | WP_047363950.1 |
| Coordinates | 4414691..4415050 (+) | Length | 120 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFK47_RS21180 (4409947) | 4409947..4410768 | + | 822 | WP_149330777.1 | DUF932 domain-containing protein | - |
| NFK47_RS21185 (4410985) | 4410985..4411686 | + | 702 | WP_149330776.1 | WYL domain-containing protein | - |
| NFK47_RS21190 (4411869) | 4411869..4412564 | + | 696 | WP_149330775.1 | hypothetical protein | - |
| NFK47_RS21195 (4412586) | 4412586..4413059 | + | 474 | WP_149330774.1 | hypothetical protein | - |
| NFK47_RS21200 (4413137) | 4413137..4413376 | + | 240 | WP_047359067.1 | DUF905 domain-containing protein | - |
| NFK47_RS21205 (4413473) | 4413473..4413934 | + | 462 | WP_047359066.1 | antirestriction protein | - |
| NFK47_RS21210 (4413946) | 4413946..4414425 | + | 480 | WP_047359065.1 | DNA repair protein RadC | - |
| NFK47_RS21215 (4414446) | 4414446..4414667 | + | 222 | WP_000691982.1 | DUF987 domain-containing protein | - |
| NFK47_RS21220 (4414691) | 4414691..4415050 | + | 360 | WP_047363950.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| NFK47_RS21225 (4415102) | 4415102..4415479 | + | 378 | WP_047359063.1 | TA system toxin CbtA family protein | Toxin |
| NFK47_RS21230 (4415476) | 4415476..4415967 | + | 492 | WP_149330773.1 | DUF5983 family protein | - |
| NFK47_RS21235 (4415996) | 4415996..4416199 | + | 204 | WP_047359061.1 | DUF957 domain-containing protein | - |
| NFK47_RS21240 (4416278) | 4416278..4417126 | + | 849 | WP_149330772.1 | DUF4942 domain-containing protein | - |
| NFK47_RS21245 (4417928) | 4417928..4419589 | + | 1662 | WP_279278675.1 | fatty acid--CoA ligase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14078.86 Da Isoelectric Point: 7.0606
>T248213 WP_047359063.1 NZ_CP099128:4415102-4415479 [Citrobacter freundii]
VQTQPLSSTHETSPRPSPVDIWQHLLNHLLDRHYGLTLNDTPFGNDGVIQEHIDAGISLCDAVNFIVEKYDLVRTDRRGF
SADTQSPLIGSIDILRARKATGLMTRHGYRPVTDLITGKYKKEQQ
VQTQPLSSTHETSPRPSPVDIWQHLLNHLLDRHYGLTLNDTPFGNDGVIQEHIDAGISLCDAVNFIVEKYDLVRTDRRGF
SADTQSPLIGSIDILRARKATGLMTRHGYRPVTDLITGKYKKEQQ
Download Length: 378 bp
Antitoxin
Download Length: 120 a.a. Molecular weight: 13207.00 Da Isoelectric Point: 6.7434
>AT248213 WP_047363950.1 NZ_CP099128:4414691-4415050 [Citrobacter freundii]
MSNKIPAENHDITEPWWGLKRSITPCFGARLVQEGNRLHYLADRASIAGTFSDADLRHLDQAFPVQLKQLELMLVSGELN
PRHQHCVTLYSKGLTCEADSLGSHGYVYIAIYPTPAATA
MSNKIPAENHDITEPWWGLKRSITPCFGARLVQEGNRLHYLADRASIAGTFSDADLRHLDQAFPVQLKQLELMLVSGELN
PRHQHCVTLYSKGLTCEADSLGSHGYVYIAIYPTPAATA
Download Length: 360 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|