Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4238303..4238819 | Replicon | chromosome |
Accession | NZ_CP099128 | ||
Organism | Citrobacter freundii strain RHB31-E4-C06 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A0D7LMW6 |
Locus tag | NFK47_RS20335 | Protein ID | WP_003839578.1 |
Coordinates | 4238303..4238587 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A0J1MV10 |
Locus tag | NFK47_RS20340 | Protein ID | WP_003839576.1 |
Coordinates | 4238577..4238819 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFK47_RS20320 (4233529) | 4233529..4235181 | + | 1653 | WP_279278667.1 | alpha,alpha-phosphotrehalase | - |
NFK47_RS20325 (4235590) | 4235590..4237728 | + | 2139 | WP_003844922.1 | anaerobic ribonucleoside-triphosphate reductase | - |
NFK47_RS20330 (4237835) | 4237835..4238299 | + | 465 | WP_032937736.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
NFK47_RS20335 (4238303) | 4238303..4238587 | - | 285 | WP_003839578.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NFK47_RS20340 (4238577) | 4238577..4238819 | - | 243 | WP_003839576.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
NFK47_RS20345 (4238897) | 4238897..4240810 | - | 1914 | WP_115454863.1 | BglG family transcription antiterminator | - |
NFK47_RS20350 (4240832) | 4240832..4241572 | - | 741 | WP_048216922.1 | KDGP aldolase family protein | - |
NFK47_RS20355 (4241569) | 4241569..4242687 | - | 1119 | WP_054527995.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
NFK47_RS20360 (4242671) | 4242671..4243804 | - | 1134 | WP_060855415.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10866.68 Da Isoelectric Point: 10.0482
>T248212 WP_003839578.1 NZ_CP099128:c4238587-4238303 [Citrobacter freundii]
MTYELEFDPRALKEWHKLGDTVKAQFKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDEVVTVFVVAVGK
REHSAVYLDANKRL
MTYELEFDPRALKEWHKLGDTVKAQFKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDEVVTVFVVAVGK
REHSAVYLDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0D7LMW6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J1MV10 |