Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3590510..3591130 | Replicon | chromosome |
| Accession | NZ_CP099128 | ||
| Organism | Citrobacter freundii strain RHB31-E4-C06 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | R8WYV2 |
| Locus tag | NFK47_RS17390 | Protein ID | WP_002892050.1 |
| Coordinates | 3590912..3591130 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | R8WZW8 |
| Locus tag | NFK47_RS17385 | Protein ID | WP_003021733.1 |
| Coordinates | 3590510..3590884 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFK47_RS17375 (3585657) | 3585657..3586850 | + | 1194 | WP_003835922.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| NFK47_RS17380 (3586873) | 3586873..3590022 | + | 3150 | WP_003021736.1 | efflux RND transporter permease AcrB | - |
| NFK47_RS17385 (3590510) | 3590510..3590884 | + | 375 | WP_003021733.1 | Hha toxicity modulator TomB | Antitoxin |
| NFK47_RS17390 (3590912) | 3590912..3591130 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
| NFK47_RS17395 (3591437) | 3591437..3591988 | + | 552 | WP_032936967.1 | maltose O-acetyltransferase | - |
| NFK47_RS17400 (3592105) | 3592105..3592575 | + | 471 | WP_003021724.1 | YlaC family protein | - |
| NFK47_RS17405 (3592654) | 3592654..3592794 | - | 141 | WP_005125190.1 | type B 50S ribosomal protein L36 | - |
| NFK47_RS17410 (3592796) | 3592796..3593056 | - | 261 | WP_003021719.1 | type B 50S ribosomal protein L31 | - |
| NFK47_RS17415 (3593245) | 3593245..3594798 | + | 1554 | WP_003835927.1 | EAL domain-containing protein | - |
| NFK47_RS17420 (3594850) | 3594850..3595203 | - | 354 | WP_003831033.1 | DUF1428 family protein | - |
| NFK47_RS17425 (3595268) | 3595268..3595897 | - | 630 | WP_279278606.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T248211 WP_002892050.1 NZ_CP099128:3590912-3591130 [Citrobacter freundii]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14427.23 Da Isoelectric Point: 5.5653
>AT248211 WP_003021733.1 NZ_CP099128:3590510-3590884 [Citrobacter freundii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2P8K6F2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | R8WZW8 |