Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2325424..2326063 | Replicon | chromosome |
| Accession | NZ_CP099128 | ||
| Organism | Citrobacter freundii strain RHB31-E4-C06 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A8B5QF36 |
| Locus tag | NFK47_RS11140 | Protein ID | WP_003020221.1 |
| Coordinates | 2325424..2325600 (+) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | NFK47_RS11145 | Protein ID | WP_123924900.1 |
| Coordinates | 2325647..2326063 (+) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFK47_RS11120 (2322202) | 2322202..2322432 | - | 231 | WP_003020233.1 | DUF2554 family protein | - |
| NFK47_RS11125 (2322622) | 2322622..2322747 | - | 126 | WP_003020230.1 | DUF2474 domain-containing protein | - |
| NFK47_RS11130 (2322747) | 2322747..2323757 | - | 1011 | WP_003020227.1 | cytochrome d ubiquinol oxidase subunit II | - |
| NFK47_RS11135 (2323757) | 2323757..2325160 | - | 1404 | WP_003843730.1 | cytochrome ubiquinol oxidase subunit I | - |
| NFK47_RS11140 (2325424) | 2325424..2325600 | + | 177 | WP_003020221.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| NFK47_RS11145 (2325647) | 2325647..2326063 | + | 417 | WP_123924900.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| NFK47_RS11150 (2326156) | 2326156..2327565 | + | 1410 | WP_003843728.1 | PLP-dependent aminotransferase family protein | - |
| NFK47_RS11155 (2327894) | 2327894..2329039 | + | 1146 | WP_003020212.1 | ABC transporter substrate-binding protein | - |
| NFK47_RS11160 (2329056) | 2329056..2330072 | + | 1017 | WP_003020210.1 | ABC transporter ATP-binding protein | - |
| NFK47_RS11165 (2330073) | 2330073..2331017 | + | 945 | WP_279278909.1 | ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6769.80 Da Isoelectric Point: 11.2510
>T248209 WP_003020221.1 NZ_CP099128:2325424-2325600 [Citrobacter freundii]
VKQSEFRRWLESQGVAVTNGSNHLKLRYQGRRSVMPRHPGDEIKEALRKAIIKQLDLQ
VKQSEFRRWLESQGVAVTNGSNHLKLRYQGRRSVMPRHPGDEIKEALRKAIIKQLDLQ
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15126.36 Da Isoelectric Point: 4.5716
>AT248209 WP_123924900.1 NZ_CP099128:2325647-2326063 [Citrobacter freundii]
MRYPVTLTPAVEGGFVVSFPDIPEALTQGNTRHDALQAAQAALITAFEFYFDDNEAIPLPSAVSAEDDYVEIPLSVASKV
LLLNAFLESKITQQELANRIGRPKQEITRLFDLKHTTKIDAVQIAARALGKELALTML
MRYPVTLTPAVEGGFVVSFPDIPEALTQGNTRHDALQAAQAALITAFEFYFDDNEAIPLPSAVSAEDDYVEIPLSVASKV
LLLNAFLESKITQQELANRIGRPKQEITRLFDLKHTTKIDAVQIAARALGKELALTML
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|