Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 825508..826162 | Replicon | chromosome |
Accession | NZ_CP099128 | ||
Organism | Citrobacter freundii strain RHB31-E4-C06 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | A0A0J1NHY7 |
Locus tag | NFK47_RS04060 | Protein ID | WP_003026936.1 |
Coordinates | 825755..826162 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | A0A6H3AT26 |
Locus tag | NFK47_RS04055 | Protein ID | WP_003026938.1 |
Coordinates | 825508..825774 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFK47_RS04030 (820709) | 820709..822142 | - | 1434 | WP_003838263.1 | 6-phospho-beta-glucosidase BglA | - |
NFK47_RS04035 (822263) | 822263..822991 | - | 729 | WP_003838265.1 | MurR/RpiR family transcriptional regulator | - |
NFK47_RS04040 (823044) | 823044..823355 | + | 312 | WP_003026949.1 | N(4)-acetylcytidine aminohydrolase | - |
NFK47_RS04045 (823518) | 823518..824177 | + | 660 | WP_003026947.1 | hemolysin III family protein | - |
NFK47_RS04050 (824271) | 824271..825251 | - | 981 | WP_016150946.1 | tRNA-modifying protein YgfZ | - |
NFK47_RS04055 (825508) | 825508..825774 | + | 267 | WP_003026938.1 | FAD assembly factor SdhE | Antitoxin |
NFK47_RS04060 (825755) | 825755..826162 | + | 408 | WP_003026936.1 | protein YgfX | Toxin |
NFK47_RS04065 (826207) | 826207..826728 | - | 522 | WP_003026933.1 | flavodoxin FldB | - |
NFK47_RS04070 (826842) | 826842..827738 | + | 897 | WP_003026928.1 | site-specific tyrosine recombinase XerD | - |
NFK47_RS04075 (827762) | 827762..828475 | + | 714 | WP_279278771.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
NFK47_RS04080 (828481) | 828481..830214 | + | 1734 | WP_016150943.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15953.89 Da Isoelectric Point: 11.4054
>T248204 WP_003026936.1 NZ_CP099128:825755-826162 [Citrobacter freundii]
VVQWQSDLRVSWRAQWLSLLIHGLVAVFILLMPWPLSYTPLWLVLLSLVVFDSVRSQRRINACQGEIRLLMDGRLRWQGQ
EWSIVSAPWMVKTGMMLRLRSDAGKRQHLWLAADSMDDAEWRDLRRLMLQKAKQK
VVQWQSDLRVSWRAQWLSLLIHGLVAVFILLMPWPLSYTPLWLVLLSLVVFDSVRSQRRINACQGEIRLLMDGRLRWQGQ
EWSIVSAPWMVKTGMMLRLRSDAGKRQHLWLAADSMDDAEWRDLRRLMLQKAKQK
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J1NHY7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6H3AT26 |