Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 276266..276852 Replicon chromosome
Accession NZ_CP099128
Organism Citrobacter freundii strain RHB31-E4-C06

Toxin (Protein)


Gene name doc Uniprot ID A0A0J1QS94
Locus tag NFK47_RS01340 Protein ID WP_032937237.1
Coordinates 276484..276852 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID A0A0J1N092
Locus tag NFK47_RS01335 Protein ID WP_032937236.1
Coordinates 276266..276487 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NFK47_RS01310 (272065) 272065..272991 + 927 WP_003023435.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
NFK47_RS01315 (272988) 272988..274265 + 1278 WP_032950432.1 branched chain amino acid ABC transporter permease LivM -
NFK47_RS01320 (274262) 274262..275029 + 768 WP_003023438.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
NFK47_RS01325 (275047) 275047..275760 + 714 WP_003827581.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
NFK47_RS01330 (275863) 275863..276144 + 282 WP_003023442.1 hypothetical protein -
NFK47_RS01335 (276266) 276266..276487 + 222 WP_032937236.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NFK47_RS01340 (276484) 276484..276852 + 369 WP_032937237.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
NFK47_RS01345 (277096) 277096..278412 + 1317 WP_003837839.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
NFK47_RS01350 (278513) 278513..279400 + 888 WP_003837841.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
NFK47_RS01355 (279397) 279397..280242 + 846 WP_003837843.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
NFK47_RS01360 (280245) 280245..281315 + 1071 WP_003837845.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 272988..282055 9067


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(1-121)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13617.91 Da        Isoelectric Point: 6.9891

>T248202 WP_032937237.1 NZ_CP099128:276484-276852 [Citrobacter freundii]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIVLSANPDFVAMTVEAAAGQLTLEQIAHRLRH

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8306.41 Da        Isoelectric Point: 4.7906

>AT248202 WP_032937236.1 NZ_CP099128:276266-276487 [Citrobacter freundii]
MRTMNYSEARQNLAEVLESAVTGVPVTITRRGHKPAVIISAEEFERYQAARLDDEFADIMMIHGNEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0J1QS94

Antitoxin

Source ID Structure
AlphaFold DB A0A0J1N092

References