Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/- |
Location | 251407..252038 | Replicon | chromosome |
Accession | NZ_CP099128 | ||
Organism | Citrobacter freundii strain RHB31-E4-C06 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A0J1MPQ6 |
Locus tag | NFK47_RS01190 | Protein ID | WP_003837806.1 |
Coordinates | 251407..251682 (+) | Length | 92 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | A0A0J1MMS0 |
Locus tag | NFK47_RS01195 | Protein ID | WP_003837808.1 |
Coordinates | 251679..252038 (+) | Length | 120 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFK47_RS01180 (247458) | 247458..250205 | + | 2748 | WP_032937231.1 | ribosome-associated ATPase/putative transporter RbbA | - |
NFK47_RS01185 (250205) | 250205..251329 | + | 1125 | WP_200083132.1 | ABC transporter permease | - |
NFK47_RS01190 (251407) | 251407..251682 | + | 276 | WP_003837806.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
NFK47_RS01195 (251679) | 251679..252038 | + | 360 | WP_003837808.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
NFK47_RS01200 (252151) | 252151..252552 | - | 402 | WP_003023387.1 | nickel-responsive transcriptional regulator NikR | - |
NFK47_RS01205 (252602) | 252602..253180 | - | 579 | WP_003023390.1 | 4'-phosphopantetheinyl transferase AcpT | - |
NFK47_RS01210 (253243) | 253243..254292 | - | 1050 | WP_003023393.1 | AI-2E family transporter | - |
NFK47_RS01215 (254426) | 254426..255643 | + | 1218 | WP_003846164.1 | MFS transporter | - |
NFK47_RS01220 (255647) | 255647..256204 | - | 558 | WP_003837816.1 | DcrB family lipoprotein | - |
NFK47_RS01225 (256277) | 256277..256942 | - | 666 | WP_003837818.1 | 7-cyano-7-deazaguanine/7-aminomethyl-7- deazaguanine transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10210.88 Da Isoelectric Point: 10.7228
>T248201 WP_003837806.1 NZ_CP099128:251407-251682 [Citrobacter freundii]
MKEKVLSLRKKQKNTLDQLFKAPTPQGIKWSEIESLIKALGGEIKEGRGSRCKFLLNKSIASFHRPHPSPDTDKGAVENV
RDWLTSIGVKP
MKEKVLSLRKKQKNTLDQLFKAPTPQGIKWSEIESLIKALGGEIKEGRGSRCKFLLNKSIASFHRPHPSPDTDKGAVENV
RDWLTSIGVKP
Download Length: 276 bp
Antitoxin
Download Length: 120 a.a. Molecular weight: 13198.98 Da Isoelectric Point: 4.5462
>AT248201 WP_003837808.1 NZ_CP099128:251679-252038 [Citrobacter freundii]
MIKPKTPNSMEIAGQPAVINYVPELNAFRGKFLGLSGYCDFVSDSIQGLQKEGEISLREYLDDCSAAGIEPYANPEKLKT
FTLRYPESFGERLSFAAAEEQVSVNTWIIETLSKSLKQA
MIKPKTPNSMEIAGQPAVINYVPELNAFRGKFLGLSGYCDFVSDSIQGLQKEGEISLREYLDDCSAAGIEPYANPEKLKT
FTLRYPESFGERLSFAAAEEQVSVNTWIIETLSKSLKQA
Download Length: 360 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J1MPQ6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J1MMS0 |