Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 4652629..4653227 | Replicon | chromosome |
Accession | NZ_CP099084 | ||
Organism | Citrobacter freundii strain RHB43-C17 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | NFK79_RS22355 | Protein ID | WP_181498734.1 |
Coordinates | 4652629..4653003 (-) | Length | 125 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | NFK79_RS22360 | Protein ID | WP_170975228.1 |
Coordinates | 4653003..4653227 (-) | Length | 75 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFK79_RS22340 (4650133) | 4650133..4651035 | + | 903 | WP_096758857.1 | formate dehydrogenase O subunit beta | - |
NFK79_RS22345 (4651032) | 4651032..4651667 | + | 636 | WP_096758858.1 | formate dehydrogenase cytochrome b556 subunit | - |
NFK79_RS22350 (4651664) | 4651664..4652593 | + | 930 | WP_181498733.1 | formate dehydrogenase accessory protein FdhE | - |
NFK79_RS22355 (4652629) | 4652629..4653003 | - | 375 | WP_181498734.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NFK79_RS22360 (4653003) | 4653003..4653227 | - | 225 | WP_170975228.1 | CopG family transcriptional regulator | Antitoxin |
NFK79_RS22365 (4653450) | 4653450..4654364 | + | 915 | WP_181498735.1 | alpha/beta hydrolase | - |
NFK79_RS22370 (4654404) | 4654404..4655345 | - | 942 | WP_153064726.1 | fatty acid biosynthesis protein FabY | - |
NFK79_RS22375 (4655390) | 4655390..4655827 | - | 438 | WP_279264522.1 | D-aminoacyl-tRNA deacylase | - |
NFK79_RS22380 (4655830) | 4655830..4656696 | - | 867 | WP_181498737.1 | virulence factor BrkB family protein | - |
NFK79_RS22385 (4656690) | 4656690..4657289 | - | 600 | WP_096758866.1 | glucose-1-phosphatase | - |
NFK79_RS22390 (4657395) | 4657395..4658198 | - | 804 | WP_096758867.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13955.13 Da Isoelectric Point: 8.4538
>T248200 WP_181498734.1 NZ_CP099084:c4653003-4652629 [Citrobacter freundii]
MVNGSALFDTNILIDLFSGRAEAKYAIETWPPQNAISLITWMEVMVGAKKYRQESRTRVALSAFNIIGVSQDIAERSVRL
RQEYGMKLPDAIILATAQIHRLTLVTRNTKDFAEIPGVITPYQE
MVNGSALFDTNILIDLFSGRAEAKYAIETWPPQNAISLITWMEVMVGAKKYRQESRTRVALSAFNIIGVSQDIAERSVRL
RQEYGMKLPDAIILATAQIHRLTLVTRNTKDFAEIPGVITPYQE
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|