Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tad-ata/COG5606-COG4679 |
Location | 4497950..4498616 | Replicon | chromosome |
Accession | NZ_CP099084 | ||
Organism | Citrobacter freundii strain RHB43-C17 |
Toxin (Protein)
Gene name | tad | Uniprot ID | A0A6N6K5Y9 |
Locus tag | NFK79_RS21665 | Protein ID | WP_005132818.1 |
Coordinates | 4498257..4498616 (-) | Length | 120 a.a. |
Antitoxin (Protein)
Gene name | ata | Uniprot ID | - |
Locus tag | NFK79_RS21660 | Protein ID | WP_096758754.1 |
Coordinates | 4497950..4498267 (-) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFK79_RS21620 (4493559) | 4493559..4494317 | + | 759 | WP_096758746.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
NFK79_RS21625 (4494391) | 4494391..4494663 | + | 273 | WP_096758747.1 | DUF3811 domain-containing protein | - |
NFK79_RS21630 (4494660) | 4494660..4495535 | - | 876 | WP_181490732.1 | 23S rRNA pseudouridine(2604) synthase RluF | - |
NFK79_RS21635 (4495786) | 4495786..4496103 | - | 318 | WP_117343617.1 | CcdB family protein | - |
NFK79_RS21640 (4496103) | 4496103..4496396 | - | 294 | WP_096758750.1 | type II toxin-antitoxin system CcdA family antitoxin | - |
NFK79_RS21645 (4496493) | 4496493..4496858 | - | 366 | WP_181498685.1 | hypothetical protein | - |
NFK79_RS21650 (4496990) | 4496990..4497163 | + | 174 | WP_096758752.1 | hypothetical protein | - |
NFK79_RS21655 (4497662) | 4497662..4497940 | + | 279 | WP_096758753.1 | putative addiction module antidote protein | - |
NFK79_RS21660 (4497950) | 4497950..4498267 | - | 318 | WP_096758754.1 | helix-turn-helix transcriptional regulator | Antitoxin |
NFK79_RS21665 (4498257) | 4498257..4498616 | - | 360 | WP_005132818.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NFK79_RS21670 (4498830) | 4498830..4499519 | + | 690 | WP_096758755.1 | dipeptidase PepE | - |
NFK79_RS21675 (4499648) | 4499648..4501279 | - | 1632 | WP_096758756.1 | Na/Pi cotransporter family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 120 a.a. Molecular weight: 13476.49 Da Isoelectric Point: 10.3799
>T248199 WP_005132818.1 NZ_CP099084:c4498616-4498257 [Citrobacter freundii]
MTKPLYWVGHARKDLQGMPEHVRDTFGFALWLAQQGKQHSQTKPLKGFGGAGVLEVVEDYHGNTWRAVYTIQLKNAVYVL
HVFQKKSVSGKATPKPEINLIYQRLKAAQRHAQESGYVT
MTKPLYWVGHARKDLQGMPEHVRDTFGFALWLAQQGKQHSQTKPLKGFGGAGVLEVVEDYHGNTWRAVYTIQLKNAVYVL
HVFQKKSVSGKATPKPEINLIYQRLKAAQRHAQESGYVT
Download Length: 360 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|