Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-YafN |
Location | 4397069..4397604 | Replicon | chromosome |
Accession | NZ_CP099084 | ||
Organism | Citrobacter freundii strain RHB43-C17 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | NFK79_RS21215 | Protein ID | WP_096758666.1 |
Coordinates | 4397317..4397604 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | D4BKM9 |
Locus tag | NFK79_RS21210 | Protein ID | WP_006688247.1 |
Coordinates | 4397069..4397320 (+) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFK79_RS21180 (4392139) | 4392139..4392930 | + | 792 | WP_137399228.1 | alpha-D-ribose 1-methylphosphonate 5-phosphate C-P-lyase PhnJ | - |
NFK79_RS21185 (4392927) | 4392927..4393685 | + | 759 | WP_096758661.1 | phosphonate C-P lyase system protein PhnK | - |
NFK79_RS21190 (4393793) | 4393793..4394473 | + | 681 | WP_117343579.1 | phosphonate C-P lyase system protein PhnL | - |
NFK79_RS21195 (4394470) | 4394470..4395606 | + | 1137 | WP_096758663.1 | alpha-D-ribose 1-methylphosphonate 5-triphosphate diphosphatase | - |
NFK79_RS21200 (4395609) | 4395609..4396154 | + | 546 | WP_096758664.1 | ribose 1,5-bisphosphokinase | - |
NFK79_RS21205 (4396227) | 4396227..4396985 | + | 759 | WP_096758665.1 | phosphonate metabolism protein PhnP | - |
NFK79_RS21210 (4397069) | 4397069..4397320 | + | 252 | WP_006688247.1 | plasmid stabilization protein | Antitoxin |
NFK79_RS21215 (4397317) | 4397317..4397604 | + | 288 | WP_096758666.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NFK79_RS21220 (4397601) | 4397601..4397930 | - | 330 | WP_096758667.1 | DDRRRQL repeat protein YjdP | - |
NFK79_RS21225 (4397999) | 4397999..4400263 | - | 2265 | WP_279264510.1 | hybrid sensor histidine kinase/response regulator | - |
NFK79_RS21230 (4400378) | 4400378..4401901 | + | 1524 | WP_279264511.1 | sugar ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11092.00 Da Isoelectric Point: 10.0828
>T248198 WP_096758666.1 NZ_CP099084:4397317-4397604 [Citrobacter freundii]
MSYTVKFREDALKEWQKLDKTIQQQFAKKLKKCCENPHVPSEKLGGIKDCYKIKLRTSGFRLVYQVIDETLVIAVVAVGK
RERSEVYNLASERLR
MSYTVKFREDALKEWQKLDKTIQQQFAKKLKKCCENPHVPSEKLGGIKDCYKIKLRTSGFRLVYQVIDETLVIAVVAVGK
RERSEVYNLASERLR
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|