Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) ykfI-yfjZ/CbtA-CbeA
Location 4097041..4097720 Replicon chromosome
Accession NZ_CP099084
Organism Citrobacter freundii strain RHB43-C17

Toxin (Protein)


Gene name ykfI Uniprot ID J7FU23
Locus tag NFK79_RS19795 Protein ID WP_015063033.1
Coordinates 4097041..4097382 (-) Length 114 a.a.

Antitoxin (Protein)


Gene name yfjZ Uniprot ID -
Locus tag NFK79_RS19800 Protein ID WP_035893676.1
Coordinates 4097403..4097720 (-) Length 106 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NFK79_RS19745 (4092310) 4092310..4092582 - 273 WP_279264490.1 DUF5405 family protein -
NFK79_RS19750 (4092579) 4092579..4093163 - 585 WP_057519812.1 3'-5' exonuclease -
NFK79_RS19755 (4093160) 4093160..4093387 - 228 WP_279264491.1 TraR/DksA family transcriptional regulator -
NFK79_RS19760 (4093387) 4093387..4093614 - 228 WP_001246237.1 DUF2732 domain-containing protein -
NFK79_RS19765 (4093682) 4093682..4094020 - 339 WP_026005870.1 DUF5347 domain-containing protein -
NFK79_RS19770 (4093984) 4093984..4094184 - 201 WP_279264492.1 DUF2724 domain-containing protein -
NFK79_RS19775 (4094192) 4094192..4094701 - 510 WP_110408942.1 phage regulatory CII family protein -
NFK79_RS19780 (4094732) 4094732..4094995 - 264 WP_279264493.1 hypothetical protein -
NFK79_RS19785 (4095130) 4095130..4095717 + 588 WP_279264494.1 phage repressor protein CI -
NFK79_RS19790 (4095717) 4095717..4096766 + 1050 WP_279264495.1 tyrosine-type recombinase/integrase -
NFK79_RS19795 (4097041) 4097041..4097382 - 342 WP_015063033.1 TA system toxin CbtA family protein Toxin
NFK79_RS19800 (4097403) 4097403..4097720 - 318 WP_035893676.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
NFK79_RS19805 (4097739) 4097739..4097960 - 222 WP_015063035.1 DUF987 domain-containing protein -
NFK79_RS19810 (4097970) 4097970..4098446 - 477 WP_015063036.1 RadC family protein -
NFK79_RS19815 (4098462) 4098462..4098941 - 480 WP_015063037.1 antirestriction protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 4050354..4106072 55718


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(6-104)


Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 13051.09 Da        Isoelectric Point: 9.9961

>T248197 WP_015063033.1 NZ_CP099084:c4097382-4097041 [Citrobacter freundii]
MKTLPATTQRAVKPCLSPVAVWQMLLTRLLEQHYGLTLNDTPFSEERVIQEHIDTGISLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAVDILRARQVTGLLRQSRKNSVR

Download         Length: 342 bp

Antitoxin


Download         Length: 106 a.a.        Molecular weight: 11837.51 Da        Isoelectric Point: 6.6246

>AT248197 WP_035893676.1 NZ_CP099084:c4097720-4097403 [Citrobacter freundii]
MSNITLGLQRDITPRLGARLVQEGNRLHYLADRASITGKFSEAECLKLDVVFPHFISQMESMLTTGEMNPRHAHCVTLYH
NDFTCEADTLGSCGYVYIAVYPTQR

Download         Length: 318 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB J7FU23

Antitoxin

Source ID Structure

References