Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 3885318..3885972 | Replicon | chromosome |
Accession | NZ_CP099084 | ||
Organism | Citrobacter freundii strain RHB43-C17 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | - |
Locus tag | NFK79_RS18700 | Protein ID | WP_096755799.1 |
Coordinates | 3885318..3885725 (-) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | - |
Locus tag | NFK79_RS18705 | Protein ID | WP_096755798.1 |
Coordinates | 3885706..3885972 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFK79_RS18680 (3881266) | 3881266..3882999 | - | 1734 | WP_096755803.1 | single-stranded-DNA-specific exonuclease RecJ | - |
NFK79_RS18685 (3883005) | 3883005..3883718 | - | 714 | WP_096755802.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
NFK79_RS18690 (3883742) | 3883742..3884638 | - | 897 | WP_096755801.1 | site-specific tyrosine recombinase XerD | - |
NFK79_RS18695 (3884751) | 3884751..3885272 | + | 522 | WP_096755800.1 | flavodoxin FldB | - |
NFK79_RS18700 (3885318) | 3885318..3885725 | - | 408 | WP_096755799.1 | protein YgfX | Toxin |
NFK79_RS18705 (3885706) | 3885706..3885972 | - | 267 | WP_096755798.1 | FAD assembly factor SdhE | Antitoxin |
NFK79_RS18710 (3886229) | 3886229..3887209 | + | 981 | WP_096755797.1 | tRNA-modifying protein YgfZ | - |
NFK79_RS18715 (3887289) | 3887289..3887948 | - | 660 | WP_096755796.1 | hemolysin III family protein | - |
NFK79_RS18720 (3888112) | 3888112..3888423 | - | 312 | WP_096755795.1 | N(4)-acetylcytidine aminohydrolase | - |
NFK79_RS18725 (3888476) | 3888476..3889204 | + | 729 | WP_115259901.1 | MurR/RpiR family transcriptional regulator | - |
NFK79_RS18730 (3889325) | 3889325..3890758 | + | 1434 | WP_181498593.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15935.93 Da Isoelectric Point: 11.2851
>T248196 WP_096755799.1 NZ_CP099084:c3885725-3885318 [Citrobacter freundii]
VVQWQSDLRVSWRAQWISLLIHGLVAVLILLMPWPLSYTPLWLILLSLVVFDCVRSQRRINACQGEIRLLMDGRLRWQGQ
EWSIVSAPWMIKTGMMLRLRSSTGKRQHLWLAADSMDDAEWRDLRRLILQPSMQK
VVQWQSDLRVSWRAQWISLLIHGLVAVLILLMPWPLSYTPLWLILLSLVVFDCVRSQRRINACQGEIRLLMDGRLRWQGQ
EWSIVSAPWMIKTGMMLRLRSSTGKRQHLWLAADSMDDAEWRDLRRLILQPSMQK
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|