Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2517224..2517863 | Replicon | chromosome |
| Accession | NZ_CP099084 | ||
| Organism | Citrobacter freundii strain RHB43-C17 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | NFK79_RS12305 | Protein ID | WP_096756975.1 |
| Coordinates | 2517687..2517863 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | NFK79_RS12300 | Protein ID | WP_137398867.1 |
| Coordinates | 2517224..2517640 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFK79_RS12280 (2512267) | 2512267..2513211 | - | 945 | WP_096756980.1 | ABC transporter permease | - |
| NFK79_RS12285 (2513212) | 2513212..2514228 | - | 1017 | WP_096756979.1 | ABC transporter ATP-binding protein | - |
| NFK79_RS12290 (2514245) | 2514245..2515390 | - | 1146 | WP_117342825.1 | ABC transporter substrate-binding protein | - |
| NFK79_RS12295 (2515721) | 2515721..2517130 | - | 1410 | WP_096756977.1 | PLP-dependent aminotransferase family protein | - |
| NFK79_RS12300 (2517224) | 2517224..2517640 | - | 417 | WP_137398867.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| NFK79_RS12305 (2517687) | 2517687..2517863 | - | 177 | WP_096756975.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| NFK79_RS12310 (2518127) | 2518127..2519530 | + | 1404 | WP_181498226.1 | cytochrome ubiquinol oxidase subunit I | - |
| NFK79_RS12315 (2519530) | 2519530..2520540 | + | 1011 | WP_181498227.1 | cytochrome d ubiquinol oxidase subunit II | - |
| NFK79_RS12320 (2520540) | 2520540..2520665 | + | 126 | WP_096756972.1 | DUF2474 domain-containing protein | - |
| NFK79_RS12325 (2520852) | 2520852..2521082 | + | 231 | WP_096756971.1 | DUF2554 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6737.76 Da Isoelectric Point: 11.2510
>T248191 WP_096756975.1 NZ_CP099084:c2517863-2517687 [Citrobacter freundii]
VKQSEFRRWLESQGVDITHGSNHVKLRYQGRRSVMPRHPGDEIKEALRKAILKQLGLS
VKQSEFRRWLESQGVDITHGSNHVKLRYQGRRSVMPRHPGDEIKEALRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15171.31 Da Isoelectric Point: 4.4938
>AT248191 WP_137398867.1 NZ_CP099084:c2517640-2517224 [Citrobacter freundii]
MRYPVNLKPAVEGGFVVSFPDIPEALTQGDSRHEALEAAQDALVTAFEFYFDDNETIPLPSAVDAADDYVEIPLSVASKV
LLLNTFLEAKITQQELASRIGRPKQEITRLFDLKHATKIDAVQAAVRALGKQLSLTMQ
MRYPVNLKPAVEGGFVVSFPDIPEALTQGDSRHEALEAAQDALVTAFEFYFDDNETIPLPSAVDAADDYVEIPLSVASKV
LLLNTFLEAKITQQELASRIGRPKQEITRLFDLKHATKIDAVQAAVRALGKQLSLTMQ
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|