Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 2259908..2260434 | Replicon | chromosome |
Accession | NZ_CP099084 | ||
Organism | Citrobacter freundii strain RHB43-C17 |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1EXL1 |
Locus tag | NFK79_RS11060 | Protein ID | WP_000323025.1 |
Coordinates | 2260147..2260434 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | S1F6D3 |
Locus tag | NFK79_RS11055 | Protein ID | WP_000534858.1 |
Coordinates | 2259908..2260147 (+) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFK79_RS11030 (2254908) | 2254908..2255789 | + | 882 | WP_279264806.1 | dsDNA nuclease domain-containing protein | - |
NFK79_RS11035 (2255789) | 2255789..2257441 | + | 1653 | WP_001575467.1 | hypothetical protein | - |
NFK79_RS11040 (2258038) | 2258038..2258478 | + | 441 | WP_279264781.1 | hypothetical protein | - |
NFK79_RS11045 (2258754) | 2258754..2259506 | - | 753 | WP_279264782.1 | hypothetical protein | - |
NFK79_RS11050 (2259779) | 2259779..2259883 | - | 105 | Protein_2161 | protein YdfV | - |
NFK79_RS11055 (2259908) | 2259908..2260147 | + | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
NFK79_RS11060 (2260147) | 2260147..2260434 | + | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
NFK79_RS11065 (2260491) | 2260491..2261414 | + | 924 | Protein_2164 | aldehyde dehydrogenase family protein | - |
NFK79_RS11070 (2261426) | 2261426..2261899 | + | 474 | WP_181499357.1 | ester cyclase | - |
NFK79_RS11075 (2261982) | 2261982..2263874 | + | 1893 | WP_181499358.1 | NAD(P)/FAD-dependent oxidoreductase | - |
NFK79_RS11080 (2263878) | 2263878..2265089 | + | 1212 | WP_096757185.1 | cytochrome c | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 2246342..2260434 | 14092 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T248189 WP_000323025.1 NZ_CP099084:2260147-2260434 [Citrobacter freundii]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|