Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 1317721..1318460 | Replicon | chromosome |
Accession | NZ_CP099084 | ||
Organism | Citrobacter freundii strain RHB43-C17 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | - |
Locus tag | NFK79_RS06295 | Protein ID | WP_096757948.1 |
Coordinates | 1317975..1318460 (+) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | - |
Locus tag | NFK79_RS06290 | Protein ID | WP_096757949.1 |
Coordinates | 1317721..1317987 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFK79_RS06260 (1312877) | 1312877..1314121 | - | 1245 | WP_096757955.1 | mechanosensitive ion channel family protein | - |
NFK79_RS06265 (1314186) | 1314186..1314839 | - | 654 | WP_096757954.1 | oxygen-insensitive NAD(P)H nitroreductase | - |
NFK79_RS06270 (1314959) | 1314959..1315327 | - | 369 | WP_181499086.1 | MmcQ/YjbR family DNA-binding protein | - |
NFK79_RS06275 (1315327) | 1315327..1315908 | - | 582 | WP_096757952.1 | TetR/AcrR family transcriptional regulator | - |
NFK79_RS06280 (1316098) | 1316098..1317195 | + | 1098 | WP_181499088.1 | MBL fold metallo-hydrolase | - |
NFK79_RS06285 (1317224) | 1317224..1317565 | + | 342 | WP_096757950.1 | RamA family antibiotic efflux transcriptional regulator | - |
NFK79_RS06290 (1317721) | 1317721..1317987 | + | 267 | WP_096757949.1 | DUF1778 domain-containing protein | Antitoxin |
NFK79_RS06295 (1317975) | 1317975..1318460 | + | 486 | WP_096757948.1 | GNAT family N-acetyltransferase | Toxin |
NFK79_RS06300 (1318734) | 1318734..1318982 | - | 249 | WP_096757947.1 | DUF1158 family protein | - |
NFK79_RS06305 (1319049) | 1319049..1320167 | - | 1119 | WP_096757946.1 | YbdK family carboxylate-amine ligase | - |
NFK79_RS06310 (1320435) | 1320435..1321139 | + | 705 | WP_096757944.1 | GNAT family protein | - |
NFK79_RS06315 (1321223) | 1321223..1322302 | + | 1080 | WP_181499089.1 | alpha/beta hydrolase | - |
NFK79_RS06320 (1322292) | 1322292..1322945 | - | 654 | WP_096757942.1 | enterobactin synthase subunit EntD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17732.53 Da Isoelectric Point: 10.0703
>T248188 WP_096757948.1 NZ_CP099084:1317975-1318460 [Citrobacter freundii]
VGRVTAPEPLSAFHQVAEFVSGEAVLDDWLKQKGLKNQALGAARTFVVCKKDTKQIAGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVELSFRGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKPSQTQQRTLFLKLP
Q
VGRVTAPEPLSAFHQVAEFVSGEAVLDDWLKQKGLKNQALGAARTFVVCKKDTKQIAGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVELSFRGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKPSQTQQRTLFLKLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|